KEGG   Pseudomonas fluorescens A506: PflA506_0035Help
Entry
PflA506_0035      CDS       T02114                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00260  Glycine, serine and threonine metabolism
pfc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01130  Biosynthesis of antibiotics
pfc01230  Biosynthesis of amino acids
Module
pfc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PflA506_0035 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PflA506_0035 (trpB)
Enzymes [BR:pfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PflA506_0035 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFJ58307
Position
complement(39522..40748)
Genome map
AA seq 408 aa AA seqDB search
MTQSQTDLRNGPDANGLFGAFGGRYVAETLMPLILDLAREYEAAKVDPAFNEELAYFQRD
YVGRPSPLYFAERLTEFCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAET
GAGMHGVATATVAARFGLQCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTGTLKDAM
NEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETRTQLQAQEGRLPDSLVAC
IGGGSNAMGLFHPFLDDTSVEIIGVEAAGHGIETGKHAASLNGGVPGVLHGNRTFLLQDD
DGQIIDAHSISAGLDYPGIGPEHAWLHDIGRVQYTSVTDDEALEAFHKCCRLEGIIPALE
SAHALAEVFKRAPNLPKDHLMVVNLSGRGDKDMQTVMHHMEQSKQEKH
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtcccagaccgatctacgcaacggccccgacgccaacggcctgttcggtgcg
ttcggcggccgctacgtcgctgaaaccctgatgccgttgattctcgacttggcccgtgaa
tacgaagcggcgaaggtagatccggcgtttaacgaagaattggcctactttcagcgcgat
tatgtcggacgcccaagcccgctgtactttgccgaacgcctcaccgagttctgcggcggc
gccaagatctacctcaagcgcgaagagctcaaccacaccggcgcgcacaagatcaacaac
tgcatcggccagatcctgctggcccggcgcatgggcaagaaacgcatcatcgccgagacc
ggcgccggcatgcacggcgtggccaccgcaactgtggcggcgcgctttggcctgcaatgc
gtgatctacatgggcaccaccgacatcgagcgccagcaggccaacgtgtttcgcatgaag
ctgctgggcgccgaggtcatccccgtggtcgccggcaccggcaccctcaaagacgccatg
aacgaagccctgcgcgactgggtcaccaacgtcgacagcaccttctacctgatcggcacc
gtggccggcccacacccatacccggcgatggtgcgcgacttccaggccgtgatcggcaag
gaaacccgcacccagctgcaagcccaggaaggccgcctgccggacagcctggtggcgtgc
atcggcggcggttccaacgccatgggcctgttccacccgttcctggatgacaccagcgtc
gagatcatcggcgttgaagccgcaggccatggcatcgaaaccggcaagcacgccgccagc
ctcaacggcggcgtcccgggcgtgctgcacggcaatcgcaccttcctgctgcaggacgac
gacggccagatcatcgacgcccactcgatttccgcaggcctggactaccccggcatcggc
ccggaacacgcctggttgcatgacattggccgcgtccaatacacctcggtaacggacgac
gaagccctggaagccttccacaaatgctgccgcctggaagggatcattcctgccctggaa
agcgcccacgccctggctgaagtattcaagcgcgcgccaaacttgcccaaggatcatctg
atggtggtcaatctctcgggccgtggcgacaaagacatgcagaccgtgatgcaccatatg
gaacagtccaagcaggagaaacactga

DBGET integrated database retrieval system