KEGG   Pseudomonas fluorescens A506: PflA506_0767Help
Entry
PflA506_0767      CDS       T02114                                 

Gene name
rluD
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pfc  Pseudomonas fluorescens A506
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pfc03009]
    PflA506_0767 (rluD)
Enzymes [BR:pfc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PflA506_0767 (rluD)
Ribosome biogenesis [BR:pfc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PflA506_0767 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AFJ58413
Position
880557..881519
Genome map
AA seq 320 aa AA seqDB search
MSDKIELRAEVPSELGGQRLDQVAAQLFAEHSRSRLSAWIKDGRLTVDGAVIRPRDIVHG
GAILELTAEQEAQGEWVAQDIELDIVYEDDDILVINKPAGLVVHPAAGHADGTLLNALLH
HVPDIINVPRCGIVHRLDKDTTGLMVVAKTIQAQTQLVTQLQSRSVSRIYECIVIGVVVA
GGKINAPIGRHGQQRQRMAVMEGGKQAVSHYRVLERFRSHTHVRVKLETGRTHQIRVHMA
HINFPLVGDPAYGGRFRIPPAASQTMVESLKTFPRQALHARFLELDHPTSGKRMSWESPL
PDDLVWLLSLLKQDREAFVG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataaaattgaacttcgcgcagaggtgccgtccgaattgggcggccaacgcctc
gatcaagtcgccgcacaattattcgctgagcactcgcgctcgcgcctttccgcctggatc
aaagacggccgcctgactgtggatggagcggttatccgcccgcgagacatagtccatggc
ggtgcgattcttgagctgactgccgagcaggaagcccagggagaatgggttgctcaggac
atcgagctggatatcgtctatgaagacgacgacatcctggtcatcaacaaacccgcaggc
ctggtggttcacccggccgccgggcacgctgatggcaccttgctcaatgccctgttgcac
cacgtgccggacatcatcaatgtgccgcgctgcggcattgttcaccgtctggacaaggac
accaccggccttatggtggtggccaagaccattcaggcgcagacgcaactggttacgcaa
ttgcagagccggagcgtcagccgcatctatgagtgcattgtgatcggcgtcgttgtggcc
ggtggcaaaatcaacgcacccattggtcgtcacggccagcagcgccagcgtatggcggtg
atggaaggtggcaagcaggccgtcagccactaccgtgtgctggagcgtttccgttcccac
acccatgtgcgggtcaagctggaaaccgggcgtacccaccagattcgcgtgcacatggcg
cacatcaacttcccgttggtcggcgacccggcctacggtggccgcttccgtattccgccg
gcggccagccagaccatggttgagtcgctcaagacgttcccgcgccaggcactgcatgca
cgcttcctggaactggatcatccgacgagcggtaagcgcatgagctgggaatcgccactg
ccagacgatctggtctggctgctgtcgctgctcaagcaggatcgcgaggcgtttgtcgga
tga

DBGET integrated database retrieval system