KEGG   Pseudomonas fluorescens A506: PflA506_1055Help
Entry
PflA506_1055      CDS       T02114                                 

Gene name
ddc
Definition
(GenBank) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00350  Tyrosine metabolism
pfc00360  Phenylalanine metabolism
pfc00380  Tryptophan metabolism
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PflA506_1055 (ddc)
   00360 Phenylalanine metabolism
    PflA506_1055 (ddc)
   00380 Tryptophan metabolism
    PflA506_1055 (ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfc04147]
    PflA506_1055 (ddc)
Enzymes [BR:pfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     PflA506_1055 (ddc)
    4.1.1.105  L-tryptophan decarboxylase
     PflA506_1055 (ddc)
Exosome [BR:pfc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PflA506_1055 (ddc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AFJ55609
Position
complement(1195990..1197396)
Genome map
AA seq 468 aa AA seqDB search
MTPEEFRQHGYAMIDLIADYRQNIEQRGVQPTTQPGEIKAALPVSPPETAEPFEQIMGDV
EKLIMPGLLHWQHPSFFGFFPSNVELSSVLGDCLSTGLGVIGLSWQSSPALTEIEEVTTD
WLRDMLGLGSTWSGVIQDSASTSTLVALISARERSSDYALMHNGLQNSGAPLIVYTSAHA
HSSVNKAAILAGFGQNHIRTIATDAHNAMSPQALAHAIAQDLAAGNTPCVVIATTGTTAA
MAIDPLAAIGDLTQRHGLWLHVDSAMAGAAMILPECRALWDGIEKADSLVLNPHKWLGAA
FDCSVYFVRDPEHLIRIMTTNPSYLQSSADGQVRNYRDWRISLGSRFRALKLWFLIREQG
VSGLQARLRRDLANARWLAEQIEASEHWTLVAKPALQTLCIRHEPPGLQGQALDHHTRAW
AEKLNQSGDAYVTPALLDERWMVRVSIGALGTERQHVQRLWARLQTLV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaagaattccgccaacatggctatgccatgatcgacctgattgcagactac
cgacagaacatcgaacaacgcggcgtgcagcccaccacccaacctggcgagatcaaagcc
gccctgccggtcagcccgcctgaaaccgccgaaccgttcgaacagatcatgggcgatgtc
gaaaaactgatcatgcccggcttgctgcattggcagcatcccagtttcttcgggttcttc
ccttccaatgtggaactgtcctcagtgctgggcgattgcctgagcaccggcctgggtgtg
attgggttgtcctggcaatccagcccggccctcaccgaaatcgaggaagtcaccaccgat
tggctgcgcgacatgctcggcctgggcagcacgtggagcggtgtgatccaggactctgcg
tccacgtccacgctggtggcgcttatcagcgcccgggaacgcagctccgattacgcgctg
atgcacaacggcctgcaaaacagcggcgcgcccctgatcgtctacacctcagcccatgcc
cacagctcggtcaacaaggcggcgatcctggccggattcggccagaaccatatccgcacc
atcgccaccgatgcacacaatgcaatgtcgccccaggcactggcgcacgccatcgcacag
gacctggccgccggcaacacgccctgcgtggtgattgccaccaccggcaccacggccgcc
atggcgatcgaccctctggcggccattggcgacctgacccaacgccacggcctgtggctg
catgtagactcggccatggctggcgccgcgatgatcctgccagaatgccgggccttgtgg
gatggcatcgaaaaggctgactccctagtgctcaacccgcacaaatggctgggcgcggcc
ttcgattgctcggtgtatttcgtgcgcgaccccgagcatttgattcgcatcatgaccacc
aacccgagttacctgcagtccagcgcagacggccaagtgcgaaactaccgtgactggcgg
atctccctgggcagccgtttccgcgcattgaagttgtggttcctgatacgcgagcaaggc
gtcagcggcctgcaagcgcggttgcggcgagacctggccaatgcgcgctggctggcagag
cagatcgaagccagcgaacactggacgctggtggccaagcccgccttgcaaaccttgtgc
attcgccatgagccgccgggtttgcaaggccaggcactggaccatcacacccgagcctgg
gcagaaaaactcaaccagtcaggcgatgcctacgtcacccccgccctcctcgatgagcgc
tggatggtgagggtgtccatcggcgcgctgggcaccgaacgccagcatgttcaaaggttg
tgggcgcggttgcaaacactggtctaa

DBGET integrated database retrieval system