KEGG   Pseudomonas fluorescens A506: PflA506_2409Help
Entry
PflA506_2409      CDS       T02114                                 

Gene name
tssC2
Definition
(GenBank) type VI secretion protein TssC2
  KO
K11900  type VI secretion system protein ImpC
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PflA506_2409 (tssC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfc02044]
    PflA506_2409 (tssC2)
Secretion system [BR:pfc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PflA506_2409 (tssC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AFJ58330
Position
2624365..2625843
Genome map
AA seq 492 aa AA seqDB search
MTTIQHGTQPVQVIESGSILDNIISQTLLSADDEAYGIAKRGVSAFIAELVKPHNCDEPV
KKRLVDRMIAEIDTKLSEQMDEILHHPDFQALEASWRGLQLLVDRTNFRENIKIELLNVS
REDLLDDFEDSSEITQSGLYKHVYSAEYGQFGGQPVGAIIANYFLSPSAPDVKLMQYASS
VAGMAHAPFIAAAGPSFFGLESFTGLPDLKDLRDHFEGPQFAKWQSFRQSEDARYIGLTV
PRFLLRTPYDPLECPVKTFAYQENVVNSHEHYLWGNTAYAFATRLTDSFARFRWCPNIIG
PQSGGAVEDLPLHHFQSMGEIETKIPTEVLISDRREYELAQEGFIALTMRKGSDNAAFFS
ASSVQKPKSFGISEEGKAAELNYRLGTQLPYMMVVNRLAHYLKVLQREQLGAWKERTDLE
LELNKWVRQYVADQENPSAEVRGRRPLRAARIVVSDVEGEPGWYRVNVTVRPHFKYMGAD
FTLSLVGKLDKE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccattcaacacggcacgcaacccgtacaggttatcgaaagcggtagcatcctc
gataacatcatttcccagacattgctcagcgccgacgacgaggcttatggcatcgccaag
cgcggcgtgtcggcgtttatcgcagagctggtcaagccacataattgtgacgaacccgta
aagaaacgcctggtcgaccggatgatcgccgagatcgacaccaagctcagcgaacaaatg
gatgagatccttcaccatccggacttccaggcgttggaggcttcgtggcgaggcttgcag
ttgctggtcgatcgcaccaattttcgcgagaacatcaagatcgaactgctgaatgtttcg
cgcgaggacctgttggatgatttcgaagattcatcggaaattacccagtccgggttatac
aagcacgtctatagcgccgaatacggtcagttcggcggtcagccagtgggcgcgatcatt
gccaattactttctttcgcccagtgcgcccgatgtgaaactgatgcaatacgcatccagc
gtcgccggcatggcccacgcgccctttatcgctgcagcggggccaagtttcttcggcttg
gaaagcttcaccgggttgcccgacctgaaggatctgcgggaccatttcgaaggcccgcag
tttgccaaatggcaaagtttccggcagagcgaagacgcacgatatattggcctcaccgtg
ccgcgctttttgctgcgcaccccgtatgacccccttgagtgcccggtcaagaccttcgcc
taccaggagaacgtggttaacagccacgagcattacttgtggggcaataccgcctatgcc
tttgccactcgcctgaccgacagcttcgcgcgctttcgctggtgccccaacattattggc
ccgcaaagcggcggggcggtcgaagacctgccgctgcatcacttccagagcatgggcgag
attgaaaccaagattcctacggaggtgctgatttcggaccgacgtgagtacgagctggca
caagaaggtttcatcgccttgaccatgcgcaagggcagcgataacgcagcgtttttttcc
gccagctccgtgcagaagcccaaatcgttcggcatcagtgaggagggcaaggcggcagag
ctgaattaccgcttgggcacccaattgccctacatgatggtggtcaaccgcctggctcat
tacctcaaagtgctgcaacgggagcagttgggcgcgtggaaagagcggacggacctggag
ttggagctcaataaatgggttcgccaatacgtggcggaccaggaaaatcccagtgccgag
gtgcgcgggcggcgccccttgcgcgctgcgcgcattgtcgtcagcgatgtcgagggcgag
cctggctggtaccgggtcaacgttacggtacgcccgcatttcaaatacatgggggcagac
ttcacgttgtccctggtcgggaagctcgataaagaatga

DBGET integrated database retrieval system