KEGG   Pseudomonas fluorescens A506: PflA506_2417
Entry
PflA506_2417      CDS       T02114                                 

Gene name
tssK2
Definition
(GenBank) type VI secretion protein TssK2
  KO
K11893  type VI secretion system protein ImpJ
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PflA506_2417 (tssK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfc02044]
    PflA506_2417 (tssK2)
Secretion system [BR:pfc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PflA506_2417 (tssK2)
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AFJ56019
Position
2632509..2633837
AA seq 442 aa
MQVHKVIWQEGMLLRPQHLQHNDRYYHQQLNQTRLLGSNTWGLLTFELNTQYLKLGKLVV
NQASGVLPDGSLFDLNAAMEPLVVQVPEGSGAQGVYLALPLVSGSHLEARRPEQSDVLAR
YLSCEVEVGDSNVGADTRCRIHCARPDLRLLLGEQPGDQHFIKLKVAQVLDASGEGGVNL
DTAFIPTFIFVQEHGYVASCLKEVIGLLASRGDAIAARIRGESTTQGTQIADFLMLQVIN
RSELELRHCLSQTRVRPEAVFRALVSLLGELSTFTTESKRAQLDVHYQHGDQGASFRGLM
AQVRTALSVVLEQQAIKLALQPRQYGVLVCPVSELKLLGTATFILAATAQCEAQELRQRL
PAHLKVAPVERIRELVNLHLAGIKVKPLPVAPRQIPFHAGKTYFVLDMSPRDIAQLEQSG
GFAFHVGGEFTGLELDFWAIRN
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcaggttcataaagttatctggcaggaaggcatgctgttgcggccacagcacttgcaa
cacaacgaccgttattaccaccagcagctcaatcagacccgcctgctgggcagtaacacc
tggggtttgctcacgttcgaactcaatacgcagtacctcaagttgggcaagctggtggtc
aaccaggccagcggcgtgttgccggacggcagcctgtttgacttgaatgctgccatggag
ccgctggtggtgcaggtgccagagggttcgggcgcgcaaggggtttacctggcgctgccg
ctggtcagcggcagtcaccttgaagcccgccggcctgagcaaagtgacgtgttggcgcgc
tacctcagctgtgaagtggaagtgggggattccaacgtgggggcggatacgcgttgccga
atccactgcgcgcgcccggacttacgtcttctgttgggtgaacagccgggtgaccagcac
ttcatcaagctcaaggtggcccaggtactcgacgccagcggtgaaggcggtgtgaacctg
gatacggcgttcatcccgacgtttatcttcgtgcaggagcatgggtacgtggcgtcgtgt
ctcaaggaggtgattggcctgcttgccagtcggggcgatgccatcgcggcgcgcattcgt
ggcgagagcacgacccaaggcacacaaatcgccgatttcctgatgctgcaagtgatcaat
cgtagtgagctggagctgcgccactgcctgagccagacgcgggtgcggcctgaagcggtg
ttccgtgcgctggtgtcgctgctcggggagctatcaaccttcaccactgaaagtaagcgc
gcgcagttggatgttcactatcaacacggcgatcagggcgccagttttcgcgggctgatg
gcgcaggtgcgtacggcactgtcggtggtgctggagcaacaggcgatcaagttggcattg
cagcctcgccagtacggggtgctggtatgcccggtcagcgagttgaaactgcttggcaca
gccaccttcatcctggcggccaccgcgcagtgtgaggcgcaggaattgcgccagcgcctg
ccagcccacctgaaagtcgcgccggttgagcgcatacgcgagttggtcaacctgcacttg
gccggtatcaaggtcaagcctttgccagtggcgccgcgacagattcctttccatgccggc
aagacctatttcgtgctcgatatgagcccccgtgatatcgcacagctggaacagtcgggt
ggtttcgctttccacgtagggggtgaattcaccgggcttgaactcgacttctgggccatc
aggaactga

DBGET integrated database retrieval system