KEGG   Pseudomonas fluorescens A506: PflA506_2699Help
Entry
PflA506_2699      CDS       T02114                                 

Definition
(GenBank) AMP-binding domain protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00010  Glycolysis / Gluconeogenesis
pfc00620  Pyruvate metabolism
pfc00640  Propanoate metabolism
pfc00680  Methane metabolism
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01120  Microbial metabolism in diverse environments
pfc01130  Biosynthesis of antibiotics
pfc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PflA506_2699
   00620 Pyruvate metabolism
    PflA506_2699
   00640 Propanoate metabolism
    PflA506_2699
  Energy metabolism
   00680 Methane metabolism
    PflA506_2699
Enzymes [BR:pfc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PflA506_2699
Lipid biosynthesis proteins [BR:pfc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PflA506_2699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFJ54865
Position
complement(2983924..2985573)
Genome map
AA seq 549 aa AA seqDB search
MREYLAATTEFDYQHTVDAALAGNLQALNACVECCDRHALPGRIALFWEGKDGRSATSTF
TELQEQAARFANFLLAQGVKRGDKVAGLLPRTAELLVVVLATWRIGAVYQPLFTAFGPKA
IEHRLNSSGAALVVTDAVNRPKLAEVADCPTIVTVAGAKGEGIVRGDYSFWAELPSYSSH
CEPVLLGAEEPFLLMFTSGTTGPSKALSVPLKAIVAFQGYMRDAVDLRPEDAFWNVADPG
WAYGIYFGVTGPLSMGHPITFYDGPFTLESTCRVINKYAITNLTGSPTAYRLLIAGGEQF
AGSIKGKLRIVSSAGEPLNPEVIRWFADHLGVTIHDHYGQTELGMVLCNHHGLAHPVHVG
SAGFASPGHRIVVLDDNHQELPAGQPGILAIDREQSPMCWFAGYDGVKTKAFVGKYYLSG
DTVELNPDGSISFVGRSDDVITTSGYRVGPFDVESALVEHPAVVEAAVVGKPCPERTELV
KAFVVISEQYRATPELAEELRLHVRQRLAAHAYPREIEFVSDLPKTPSGKLQRFILRNQE
IAKAQAAVA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtatttggctgccaccaccgagtttgattaccagcacaccgtcgacgccgca
ctggccggcaacctgcaagcgctcaatgcctgcgtggaatgctgtgaccgtcacgcgttg
ccggggcgcatcgcgttgttctgggagggcaaggacggacgcagcgccacgtcaaccttt
accgaactgcaagagcaggccgcgcgtttcgccaacttcctcttggcccagggcgtcaag
cgcggtgacaaggtggcgggcctgttgccccgtactgccgaattgttggtggtcgtgctg
gcgacgtggcgcatcggcgcggtctatcagccgctgtttaccgcgttcggacccaaggca
attgaacatcgcttgaacagctcgggcgcagcgctggtggtcaccgatgcagtgaaccgt
cccaagctggcggaagtcgccgactgcccgaccatcgtcacggtcgccggggccaagggc
gaaggtatcgtgcggggcgactacagcttctgggccgaactgcccagctactcttctcac
tgcgagccggtgctgctgggcgcagaggagccgttcctgctgatgttcacctccggcacc
accgggccgtccaaggcgctgtcggtaccgctcaaggccatcgtcgcgttccagggctac
atgcgcgacgccgtggacttgcgccccgaggacgcattctggaacgttgccgaccctggc
tgggcctatggcatctatttcggcgtgaccgggccgttgtccatggggcacccgatcacc
ttctacgatggcccgttcaccctggaaagcacctgccgggtcatcaataaatacgcgatc
accaacctgaccggttcgcccacggcgtatcggctgttgattgccggtggcgaacagttc
gccggttcgatcaagggcaagctgcgcatcgtcagcagcgccggtgagcctttgaacccg
gaggtgatccgctggttcgccgaccacctgggcgtgaccatccacgaccattacggccag
accgagctgggcatggtgctgtgcaatcaccatggtttggcgcatccggtgcatgtgggc
tcggcgggttttgcctcgccagggcatcgcatcgtggtgctggatgacaaccatcaggag
ctgccagccggccaacccggcatcctggccatcgaccgcgagcaatcgcctatgtgctgg
tttgccgggtacgacggcgtgaaaaccaaggcgttcgtcggcaagtactacctcagcggc
gataccgtggagctgaacccggacggcagcatcagctttgtcggacgcagcgacgacgtg
atcactacatccggctaccgcgtgggccccttcgacgtggaaagcgcgttggtcgaacac
ccggcggtggtcgaggctgccgtggtcggcaagccttgcccggagcgaactgagctggtc
aaagcctttgtggtgatcagcgagcaataccgcgccaccccggagctggctgaagagctg
cgcctgcatgtgcgccagcgcctggccgcccatgcgtacccgcgggaaatcgaatttgtc
agcgacttgcccaagaccccgagcggcaagctgcaacgctttattttgcgcaatcaggaa
atagccaaggcccaggcggccgtggcttga

DBGET integrated database retrieval system