KEGG   Pseudomonas fluorescens A506: PflA506_3525Help
Entry
PflA506_3525      CDS       T02114                                 

Gene name
yneI
Definition
(GenBank) succinate semialdehyde dehydrogenase, NAD+-dependent
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00250  Alanine, aspartate and glutamate metabolism
pfc00650  Butanoate metabolism
pfc00760  Nicotinate and nicotinamide metabolism
pfc01100  Metabolic pathways
pfc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PflA506_3525 (yneI)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PflA506_3525 (yneI)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PflA506_3525 (yneI)
Enzymes [BR:pfc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     PflA506_3525 (yneI)
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     PflA506_3525 (yneI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AFJ58375
Position
3927703..3929097
Genome map
AA seq 464 aa AA seqDB search
MNNAISHQTHALSINPASGETVGSYPYESAEQLNAALARSTDAFRTWRRTPVSQRAEYLL
ALAAALREQAEDMAQMITLEMGKPIAQARAEIEKCAQLSEWYAAHGPAMLAPEPTLVDNG
SARIEYRPLGPILAVMPWNFPVWQVLRGAVPTLLAGNTYVLKHAPNVMGSAYLIQQALRK
AGFTEGVFEVINVTQDGVSTAIADPRIAAVTLTGSVRAGIAIGSQAGAALKKCVLELGGS
DPFIVLNDADLDAAVQAAVIGRFQNSGQVCAAAKRLIIEAGVVEAFTAKFLEASRALVMG
EPTSYSTYIGPMARFDLRDELHGQVQATLEEGATLLLGGHKVAGAGNYYEPTVLADVTDQ
MTSFKQELFGPVASIITARDAEHAVALANDSEFGLTASIFTADSAKARAIADQLETGGIF
VNAFSVSDPRVAFGGVKKSGFGRELSHFGVREFCNAQTVWLDRK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgctatctcccaccagacccacgccctgtcgatcaaccccgccagcggcgaa
acagtcggcagctacccctacgaaagcgcagaacagctgaacgccgccctcgcccgctcg
accgatgccttccgcacctggcgccgcacgcctgtgagccagcgcgccgaatacctgctg
gccctggctgccgccctgcgtgagcaagctgaagacatggcgcaaatgatcacccttgaa
atgggcaaacccatcgcccaggcccgcgccgaaatcgaaaagtgcgcccaactgagcgaa
tggtacgccgcccacggcccggccatgctcgccccggagcccaccctggtggacaacggc
agcgcccggatcgaataccgcccactgggcccgatcctcgcggtaatgccgtggaatttc
ccggtatggcaagtgctgcgcggcgcggtgccgaccctgcttgccggcaacacctacgta
ctcaaacacgcgccaaatgtgatgggcagcgcctacctgatccagcaagcgttgcgcaaa
gccggttttactgaaggcgtgtttgaagtcatcaacgtaacccaggacggcgtgtccacc
gccatcgccgacccgcgcatcgccgctgtgaccctcaccggcagcgtgcgcgctggcatc
gccatcggctcacaggccggggccgcgttgaagaaatgcgtgctggaactgggcggctcc
gacccctttatcgtgctcaacgacgctgacctcgacgccgccgtacaagccgctgtcatc
ggccgcttccagaacagcggccaagtctgcgccgccgccaagcgcttgatcatcgaagcg
ggcgtggttgaagccttcaccgccaaattcctagaagccagccgcgccctggtgatgggc
gagcccacctcctacagcacctatatcggccccatggcgcgctttgatctgcgtgacgaa
ctgcacggccaggtccaggcgaccctggaagaaggcgccacgctgctgctgggtggccat
aaagtcgcgggcgcgggcaattactacgaaccgaccgtcctggctgacgtcaccgaccaa
atgacgtcgttcaaacaggaactgttcggcccagtagcctcgatcatcaccgcccgcgac
gccgagcacgccgtggcgctggccaatgacagcgagtttggcctgaccgcgagtatcttc
acagccgattccgcaaaggcgcgggcgattgccgaccagttggaaaccggcgggatattc
gtcaacgcgttcagcgtctcagacccgcgggtggcgtttggtggtgtgaagaagagcggg
ttcggccgcgagctgtcgcacttcggtgtacgcgagttctgcaacgcacaaacggtgtgg
ctggaccgcaagtaa

DBGET integrated database retrieval system