KEGG   Pseudomonas fluorescens A506: PflA506_3949Help
Entry
PflA506_3949      CDS       T02114                                 

Definition
(GenBank) HAD hydrolase, family IA, variant 3
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
pfc  Pseudomonas fluorescens A506
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pfc01009]
    PflA506_3949
Enzymes [BR:pfc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     PflA506_3949
Protein phosphatases and associated proteins [BR:pfc01009]
 HAD phosphatases
  Other HAD phosphatases
   PflA506_3949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AFJ57317
Position
complement(4381751..4382437)
Genome map
AA seq 228 aa AA seqDB search
MNAPRTAVPIKAVIFDMDGLLLDTEGIYTEVTQIIAERYGRTYDWGIKQHIIGRGAQDLA
DYVVKALDLPITPAEFLEIREPLMSERFPKAQGMPGAEALVRHLKAHNIPIAVGTSSSRN
SFGHKTTLHREWFGLFDTIVTADDPEVGAAKPAPDIFLTAARRLGVAPEDCLVFEDSPFG
VTAAKAAHMTAIAVPDEAMADSKYQHADQIIRKLADFDLAAYGLPPMA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaccgcgtaccgctgtcccgatcaaagccgtgattttcgatatggacgggttg
ttgctggataccgaaggcatctacaccgaagtcacgcagatcattgccgaacgctatggt
cgtacctacgactggggcatcaagcagcacatcatcgggcggggtgcccaggatttggcc
gattacgtggtcaaggccctggacctgccgatcacgcccgccgagtttctggaaatacgc
gaaccgctgatgagcgagcgctttcccaaggcccagggcatgcccggcgccgaggcgttg
gtgcggcacctgaaggcgcacaatattccgattgcggtgggcaccagttcatcgcgtaac
tcgtttggccacaagactaccctgcaccgtgaatggtttggcctgttcgacaccatcgtc
actgccgatgacccggaagtcggcgccgccaagccagcgccggatatcttcctcaccgcc
gcgcgccggttgggtgtagcgcctgaggattgcctggtgttcgaagactcgccgttcggc
gtgacggcggcgaaggctgcgcacatgaccgctattgcggtgcccgatgaggcgatggct
gacagcaagtaccagcatgctgaccagattattcgcaagcttgctgactttgatttggcc
gcctacggcttgcctcccatggcctga

DBGET integrated database retrieval system