KEGG   Pseudomonas fluorescens A506: PflA506_3967Help
Entry
PflA506_3967      CDS       T02114                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00071  Fatty acid degradation
pfc00072  Synthesis and degradation of ketone bodies
pfc00280  Valine, leucine and isoleucine degradation
pfc00310  Lysine degradation
pfc00362  Benzoate degradation
pfc00380  Tryptophan metabolism
pfc00620  Pyruvate metabolism
pfc00630  Glyoxylate and dicarboxylate metabolism
pfc00640  Propanoate metabolism
pfc00650  Butanoate metabolism
pfc00900  Terpenoid backbone biosynthesis
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01120  Microbial metabolism in diverse environments
pfc01130  Biosynthesis of antibiotics
pfc01200  Carbon metabolism
pfc01212  Fatty acid metabolism
pfc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PflA506_3967
   00630 Glyoxylate and dicarboxylate metabolism
    PflA506_3967
   00640 Propanoate metabolism
    PflA506_3967
   00650 Butanoate metabolism
    PflA506_3967
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PflA506_3967
   00072 Synthesis and degradation of ketone bodies
    PflA506_3967
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PflA506_3967
   00310 Lysine degradation
    PflA506_3967
   00380 Tryptophan metabolism
    PflA506_3967
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PflA506_3967
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PflA506_3967
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PflA506_3967
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfc04147]
    PflA506_3967
Enzymes [BR:pfc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PflA506_3967
Exosome [BR:pfc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PflA506_3967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFJ59460
Position
complement(4396893..4398098)
Genome map
AA seq 401 aa AA seqDB search
MTQALIFDAIRTPRGKGKADGALHSVKPVNLVAGLLTALAQRSDLDTRQVDDIVLGCVTP
VGDQGADIAKTAALVADWDVSVAGVQVNRFCASGLEAVNLGAMKVRSGFEDLVVVGGVES
MSRVPMGSDGGAWVLDPQTNMHSHFTPQGIGADLIATLEGFTRQDVDAFALQSQQKAARA
RADGSFNKSLIAVHDQNGIVLLDHDEFIRGDSTLEGLGKLKPSFEMMGQMGFDATALRVY
SHVERIHHVHTPGNSSGIVDGAALMLIGSEAKGRELGLQPRARIVATAVTSTDPTIMLTG
PAPATRKALAKAGLRVEDIDLFEVNEAFASVVLKFIKDMGIDAARVNVNGGSIAMGHPLG
ATGCAILGTLLDELEARQQRYGLATLCVGGGMGIATIIERL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagctttgatttttgatgcgatacgcacgccccggggtaagggcaaggccgac
ggtgccctgcacagcgtcaagccggtaaacctggtggctggcttgctcacggcgctggcg
cagcgcagcgacctcgacacccgccaagtggatgacatcgtcctgggctgcgtcacgccc
gttggcgaccagggcgccgatatcgccaagaccgccgcgctggtggccgactgggatgtc
agtgtggccggtgtgcaggtcaatcgcttctgcgcgtcgggcctggaagcggtgaacctg
ggggcgatgaaggtgcgttccggcttcgaagacctggtggttgttggcggcgtcgagtcc
atgtcccgcgtgcccatgggcagcgatggcggcgcctgggtactcgacccgcaaaccaat
atgcacagccacttcacgccccaaggcattggcgccgacctgattgccaccctggaaggc
ttcacgcgccaggatgtcgacgcctttgccctacagtcccagcagaaagcagccagggcg
cgggcagacggttccttcaataagtcgctaatcgcggtgcacgaccagaacggcatcgtg
ctgctggaccatgacgaatttatccgcggcgactcaaccctcgagggcttgggcaagctc
aagccgagcttcgaaatgatgggccagatgggtttcgacgccaccgcgttgcgggtctac
agccacgtggagcgcatccaccatgtgcacacgccgggcaacagttccggcattgtggat
ggcgccgcgttgatgctgatcggttccgaggccaaaggccgtgaactgggcctgcaaccg
cgggcgcgtattgtcgccacggcggtgaccagtaccgacccgaccatcatgctcaccggc
cccgcgccggccactcgcaaggcgctggccaaggctggcctgcgggtcgaggacatcgac
ctgttcgaagtcaacgaagccttcgcttcggtcgtgctcaagttcatcaaggacatgggc
atcgacgccgcacgggtcaatgtcaacggcggctccatcgccatgggccaccccttgggc
gccaccggctgcgcgattctcggcaccttgctcgacgagctggaggcgcgccagcaacgc
tacggcctggccactttatgcgtcggcggtggcatgggtatcgccaccatcatcgaacgt
ctctga

DBGET integrated database retrieval system