KEGG   Pseudomonas fluorescens A506: PflA506_4552Help
Entry
PflA506_4552      CDS       T02114                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00010  Glycolysis / Gluconeogenesis
pfc00051  Fructose and mannose metabolism
pfc00562  Inositol phosphate metabolism
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01120  Microbial metabolism in diverse environments
pfc01130  Biosynthesis of antibiotics
pfc01200  Carbon metabolism
pfc01230  Biosynthesis of amino acids
Module
pfc_M00002  Glycolysis, core module involving three-carbon compounds
pfc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PflA506_4552 (tpiA)
   00051 Fructose and mannose metabolism
    PflA506_4552 (tpiA)
   00562 Inositol phosphate metabolism
    PflA506_4552 (tpiA)
Enzymes [BR:pfc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PflA506_4552 (tpiA)
Exosome [BR:pfc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PflA506_4552 (tpiA)
  Exosomal proteins of bladder cancer cells
   PflA506_4552 (tpiA)
  Exosomal proteins of melanoma cells
   PflA506_4552 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFJ54826
Position
complement(5015054..5015809)
Genome map
AA seq 251 aa AA seqDB search
MRRTMVAGNWKMHGTRASVAELINGLRHLALPSGVDVAVFPPCLHINQVVDGLKGKSIQV
GAQNSAVEPMQGALTGEISPSQLVDAGCSYVLVGHSERRQMMGERDGTLNRKFAAAQACG
LIPVLCIGETLEQRESGKTLEVVSRQLGSIIEELGVGAFAKAVIAYEPVWAIGTGLTATP
QQAQDVHAAIRAQLAAENSEVAQGVRLLYGGSVKAANAVELFGMPDIDGGLIGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcactatggtagctggtaactggaagatgcacggtacccgcgccagtgtcgct
gagctgatcaacggccttcgtcacttggccttgcctagcggtgttgacgtcgcggtgttc
ccgccttgcttgcatatcaaccaagtggttgatggcttgaagggcaagtcgattcaggtc
ggcgcgcagaactctgcggtagagccgatgcaaggtgcgttgaccggcgagatttcgccg
agtcagctggttgatgcgggttgttcctatgtgcttgtcgggcactccgagcgtcgccag
atgatgggcgagcgggatgggacgctcaaccgcaagttcgccgcagcacaggcttgtggc
ttgattccggtgttgtgcataggggagacccttgagcagcgcgaatcgggcaagactctt
gaagttgtctcgcgtcagctgggcagcatcatcgaggagctgggtgttggtgcatttgca
aaggcagttattgcttacgagccggtctgggccattggcaccgggctgactgctacgccg
caacaggcgcaggatgtgcacgcagccatccgcgcgcagttggcggcagagaattctgaa
gtcgcacaaggtgtgcggcttctatacggcggcagcgtgaaggcggccaatgcggtcgaa
ctgttcggcatgccggatatcgatggggggctcattggtggagcttccctgaatgcagat
gagttcggtgcgatctgtcgcgccgcgggaaactga

DBGET integrated database retrieval system