KEGG   Pseudomonas fluorescens A506: PflA506_5301
Entry
PflA506_5301      CDS       T02114                                 

Gene name
tssB1
Definition
(GenBank) type VI secretion protein TssB1
  KO
K11901  type VI secretion system protein ImpB
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PflA506_5301 (tssB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfc02044]
    PflA506_5301 (tssB1)
Secretion system [BR:pfc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PflA506_5301 (tssB1)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFJ56838
Position
5803694..5804200
AA seq 168 aa
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPLAPVADRK
FLEVDVDNFDSRLKAMQPRVAFHVPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLNQ
LLEARTQLANLLTYMDGKTGAEEIIMKAIKDPALLQALASAPKPAGEQ
NT seq 507 nt   +upstreamnt  +downstreamnt
gtggcgaagcaaagttctcagaaattcatcgcgcgcaaccgtgcgcctcgagtgcagatc
gagtacgacgtcgagctttacggcgccgagaaaaaggtccagctgcccttcgtgatgggc
gtgatggccgacctcgccggcaagcctgccgagccgctggcccccgtggccgaccgcaag
ttccttgaggtggacgtcgacaacttcgactcacgcctcaaggccatgcagccacgcgtc
gcgttccacgtacccaatgagctgacaggcgaaggcaacctgagcctggacatcaccttc
gaaagcatggacgacttcagcccggccgccgtggcccgcaaggtcgactccctgaatcag
ctgctcgaagcccgcacccaattggccaacctgctgacctacatggacggcaagactggc
gctgaagaaatcatcatgaaggcgatcaaggacccggcattgcttcaggcacttgccagc
gcgcccaagcctgcaggggagcagtaa

DBGET integrated database retrieval system