KEGG   Pseudomonas fluorescens A506: PflA506_5308
Entry
PflA506_5308      CDS       T02114                                 

Gene name
vgrG1
Definition
(GenBank) type VI secretion protein VgrG1
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PflA506_5308 (vgrG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfc02044]
    PflA506_5308 (vgrG1)
Secretion system [BR:pfc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PflA506_5308 (vgrG1)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C
Other DBs
NCBI-ProteinID: AFJ56013
Position
5812604..5814550
AA seq 648 aa
MLFNQASRLAKINSPLGPDVLLLNEMGGGEELGRLFNYELQLTSLDANIDLNQLLGKPMS
VGLQLADGGERHFHGIVARCSQNIDKGQFASYQVTLRPWLWLLSRTSDCRIFQNLSIPQI
IKQVFRDLGFSDFEDALSRPYREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEQDRHVL
VLADAYGAHTSVPGYASIPYYPKDEQQRERDHMHNWHLAQEVQPGSLELNDYDFQRPSAS
IDVRSAMPRPHTAGDYPLYDYPGTYVQSADGEHYARTRIEALQTLHEQIEFSGNARGLGS
GHLFSLTGFSRQDQNREYLIVGCRYFIVQESLESGGGSGSAQFESSLTCIDAQQSFRPLA
NTHRPIVKGPQTALVVGPKGEEIWTDQYGRVKVHFYWDRHDQSNENSSCWIRVSQSWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPENATQSGMKSRSSKGG
TPANFNEIRMEDKKGLEQLYIHAERNQDIVVEVDESHSVGHDRNKNIGHNETVTIGSNRL
RVVRNNDTVIVGGAKSDSAATSYTIEAGESLRLVCGDSVIELKAGGDINLTCGSFNLFST
GSSKIQTKGKLDINLGSDKGTSPGAQGVQSTIKSAVESKFPGKPGAGQ
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgctattcaaccaagcctcacgcctggccaagatcaacagccccctcgggccggatgtg
ctgctgctcaacgaaatgggcggcggtgaagagttgggccggctgttcaactatgagctg
caactgacgtccctggacgccaacatcgacctgaaccaattgctgggtaaaccgatgagc
gtcggcctgcaactggcggacggcggcgagcggcatttccacgggatcgttgcgcggtgc
agccagaacatcgacaaaggccagttcgccagttaccaagtcaccctgcgcccttggctg
tggttgctcagccgcacctccgactgccggattttccagaacctgagcatcccgcagatc
atcaagcaggtgttccgtgacctgggtttttccgactttgaagacgccctcagccggccg
tatcgcgagtgggagtactgcgtgcagtaccgcgagaccagcttcgatttcgtcagccga
ctgatggaacaggaaggcatctactacttcttccgccatgaacaggaccgccatgtgctg
gtgctggccgacgcctatggcgcccacaccagcgtgcccggctacgcgtcgatcccctac
taccccaaggacgagcagcagcgcgaacgcgaccatatgcacaattggcacctggcgcag
gaggtgcagccgggctcgctggagctgaacgactacgacttccagcgccccagcgcgagc
atcgacgtgcgctcggccatgccgcgcccgcacaccgccggcgactacccgctgtacgac
taccccggtacctacgtgcaaagcgccgacggcgaacactatgcgcgcacccgcatcgag
gccctgcaaaccctgcatgaacagatcgagttcagcggcaatgcgcgcgggctgggctcg
ggccatctgttcagcctcaccggtttcagtcgccaggaccagaaccgcgagtacctgatc
gtcggttgccgctacttcatcgtgcaagaaagcctggaaagcggtggcggttcaggctcg
gcgcagtttgaaagcagcctgacctgcatcgacgcccaacagagtttccgcccgctggcc
aatactcaccgccccatcgtcaaaggcccgcagaccgccttggtggtaggccccaagggc
gaggaaatctggaccgaccagtacggccgcgtgaaggtgcacttctactgggaccgccac
gaccaatccaacgagaacagctcgtgctggattcgtgtgtcgcaatcctgggccggcaag
aactggggctcgatgcagattccgcgcatcggccaagaggtgatcgtcagcttcctcgaa
ggcgaccccgaccgaccgatcatcaccgggcgggtctacaacgctgagcagacggtgccc
tacgacttgccggagaacgccacccagagcggcatgaaaagtcgctccagcaaaggcggc
acgccggccaacttcaatgaaatccgcatggaggacaagaagggcttggagcagttgtat
atccatgccgagcgtaaccaggacatcgtggtggaggtggatgaaagccactcggtgggg
catgaccgcaacaagaatattgggcataacgagacggtgaccattggcagtaaccgcctg
cgggttgtgcgcaataacgacacggtgatcgtgggcggtgccaagtccgacagcgccgcc
acgagttacaccatcgaggccggcgagagtcttcgcctggtgtgcggcgacagcgtgatt
gagctcaaggctggcggcgacatcaacctgacctgtggctcgttcaacctgttttccacc
ggcagcagcaagatccagacgaagggcaagctggacatcaacctgggcagcgacaaaggc
acttcgccgggtgcccagggcgtgcaaagcacgatcaagtccgccgtcgagtcaaaattc
cccggtaagcccggtgctggtcaataa

DBGET integrated database retrieval system