KEGG   Plasmodium falciparum Dd2: PFDG_00419
Entry
PFDG_00419        CDS       T01051                                 

Name
(Broad) hypothetical protein
  KO
K13725  M1-family aminopeptidase [EC:3.4.11.-]
Organism
pfd  Plasmodium falciparum Dd2
Brite
KEGG Orthology (KO) [BR:pfd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pfd01002]
    PFDG_00419
Enzymes [BR:pfd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     PFDG_00419
Peptidases and inhibitors [BR:pfd01002]
 Metallo peptidases
  Family M1
   PFDG_00419
SSDB
Motif
Pfam: DUF3458_C Peptidase_M1 DUF3458 Peptidase_M1_N Phi-29_GP4
Structure
PDB: 

AA seq 1085 aa
MKLTKGCAYKYIIFTVLILANILYDNKKRCMIKKNLRISSCGIISRLLKSNSNYNSFNKN
YNFTSAISELQFSNFWNLDILQKDIFSNIHNNKNKPQSYIIHKRLMSEKGDNNNNNHQNN
NGNDNKKRLGSVVNNEENTCSDKRMKPFEEGHGITQVDKMNNNSDHLQQNGVMNLNSNNV
ENNNNNNSVVVKKNEPKIHYRKDYKPSGFIINNVTLNINIHDNETIVRSVLDMDISKHNV
GEDLVFDGVGLKINEISINNKKLVEGEEYTYDNEFLTIFSKFVPKSKFAFSSEVIIHPET
NYALTGLYKSKNIIVSQCEATGFRRITFFIDRPDMMAKYDVTVTADKEKYPVLLSNGDKV
NEFEIPGGRHGARFNDPHLKPCYLFAVVAGDLKHLSATYITKYTKKKVELYVFSEEKYVS
KLQWALECLKKSMAFDEDYFGLEYDLSRLNLVAVSDFNVGAMENKGLNIFNANSLLASKK
NSIDFSYARILTVVGHEYFHNYTGNRVTLRDWFQLTLKEGLTVHRENLFSEEMTKTVTTR
LSHVDLLRSVQFLEDSSPLSHPIRPESYVSMENFYTTTVYDKGSEVMRMYLTILGEEYYK
KGFDIYIKKNDGNTATCEDFNYAMEQAYKMKKADNSANLNQYLLWFSQSGTPHVSFKYNY
DAEKKQYSIHVNQYTKPDENQKEKKPLFIPISVGLINPENGKEMISQTTLELTKESDTFV
FNNIAVKPIPSLFRGFSAPVYIEDNLTDEERILLLKYDSDAFVRYNSCTNIYMKQILMNY
NEFLKAKNEKLESFNLTPVNAQFIDAIKYLLEDPHADAGFKSYIVSLPQDRYIINFVSNL
DTDVLADTKEYIYKQIGDKLNDVYYKMFKSLEAKADDLTYFNDESHVDFDQMNMRTLRNT
LLSLLSKAQYPNILNEIIEHSKSPYPSNWLTSLSVSAYFDKYFELYDKTYKLSKDDELLL
QEWLKTVSRSDRKDIYEILKKLENEVLKDSKNPNDIRAVYLPFTNNLRRFHDISGKGYKL
IAEVITKTDKFNPMVATQLCEPFKLWNKLDTKRQELMLNEMNTMLQEPNISNNLKEYLLR
LTNKL
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgaaattaacaaaaggctgtgcctataaatatattattttcacagtgttaattttagcg
aatattctttatgataataaaaaaaggtgcatgattaaaaaaaatttacgtattagttcg
tgcggtataataagtcgcttgctcaaatctaattcaaattataatagttttaataagaat
tataatttcacgtctgctatatcagaattacaattttccaatttttggaatttagatatt
ttacaaaaggatatatttagtaatatacataataacaaaaacaagcctcaatcatatata
atacataaaagactaatgagtgagaaaggagataataataataataatcaccaaaataat
aatgggaatgacaataagaaaagattaggatctgttgtaaataatgaagaaaatacttgt
tcagataaaagaatgaaaccttttgaagaaggtcatggaattacacaagttgataagatg
aataacaacagtgatcatttacaacaaaatggtgttatgaatttgaatagtaataatgtt
gaaaataataataataacaattctgttgttgttaaaaagaacgaaccaaaaatacattat
aggaaagattataaaccaagtggatttataattaataatgtaacattaaatattaatatc
catgacaatgaaactattgtaagatctgtacttgatatggatattagtaaacacaatgtt
ggtgaagatttagtttttgatggtgttggattaaaaattaatgagataagtattaataat
aagaaattagttgaaggagaagaatatacctacgataatgaattcttaactatattttca
aaatttgtaccaaaatctaaatttgctttttcatcagaagttattatacatccagaaaca
aattatgctcttacaggtttatataaatcaaaaaatattattgtttctcaatgtgaagct
accggattccgtcgtatcactttttttattgacagaccagatatgatggcaaaatatgac
gttacagtaactgctgataaagaaaaatatcctgttttattaagtaatggtgataaggtg
aatgaatttgaaataccaggtggtcgtcatggagctagatttaatgatccccatttaaaa
ccatgttatttatttgctgttgtagctggtgaccttaaacatttaagtgctacatatatt
actaaatataccaaaaaaaaagttgaattatatgtatttagtgaggaaaaatatgtatct
aaattacaatgggctttagaatgtcttaaaaaatcgatggcatttgatgaagattatttt
ggattggaatatgatttgtctcgtttaaatttagttgctgtttctgactttaatgttggt
gctatggaaaataaaggattaaatatatttaatgctaattctttattagcatccaaaaaa
aattcaattgatttttcatatgcaagaattctaacggtcgtaggacatgaatatttccat
aattatacaggaaatagagttactcttagagattggtttcagttaacattaaaagaaggt
ctaacagtacatagagaaaatttgttttcagaagaaatgacgaagaccgtaactactcgt
ttatctcatgtagatttattaagaagtgttcaatttttagaagattcctcaccattatca
caccctattagaccagaatcttatgttagtatggaaaacttttatactactactgtttat
gataaaggtagtgaagttatgagaatgtatcttactatattaggtgaagaatattataaa
aaaggttttgatatttatattaagaaaaatgatggaaatactgctacttgtgaagatttt
aattatgctatggaacaagcatataaaatgaaaaaagcagacaattcagctaacctaaac
caatatttattatggttctcacaaagtggtactccacatgttagttttaaatataactac
gatgctgaaaagaaacaatatagtatacatgttaatcaatataccaaaccagatgaaaac
caaaaagaaaagaaacctttatttattcctataagtgttggcttaattaatccagaaaac
ggtaaagaaatgatatcacaaaccaccttagaattaacaaaagaaagtgatacatttgta
tttaataatatagctgtaaaaccaataccatccttattcagaggatttagtgcaccagta
tatattgaggataacttaacagatgaagaacgtatattattattgaaatatgatagtgat
gcttttgttcgttataactcatgtaccaatatatatatgaaacaaatattaatgaattat
aatgaattcttaaaagctaaaaatgaaaaattagaaagttttaatcttacaccagtaaat
gcacaatttatagatgctataaaatatttattagaagacccacatgctgatgcaggattt
aaatcatatatagtatccttaccacaagatagatatataataaactttgtaagcaattta
gatacagacgtattagctgatactaaagaatatatatataaacaaatcggagataaatta
aatgatgtatattataaaatgtttaaaagtttagaagcaaaagctgatgatttaacatat
tttaatgatgaatcacatgtagattttgatcaaatgaatatgagaacattaagaaataca
ttattatcattattaagtaaagctcaatatccaaatatattaaatgaaattattgaacat
tccaaatcaccatatccatccaattggctaactagtttatcagtttcagcatatttcgat
aaatattttgaactttatgataaaacttataaattatcaaaagatgatgaattattgtta
caagaatggttaaagactgtatcaagatctgatcgtaaagatatatatgaaatacttaaa
aaattagaaaatgaagttttgaaagatagtaaaaatccaaatgatattagagcagtatat
cttccatttacaaataatttaagaagattccatgatatatcaggaaaagggtataaatta
attgctgaagttattacaaaaaccgataaatttaatcctatggttgcaacacaattatgt
gaaccatttaaattatggaataaactagatacaaaaagacaagaattaatgcttaacgaa
atgaacacaatgttacaagaaccaaacatatcaaataacttaaaggaatatttattaaga
ttaacaaataaattataa

DBGET integrated database retrieval system