KEGG   Plasmodium falciparum Dd2: PFDG_00609Help
Entry
PFDG_00609        CDS       T01051                                 

Definition
(Broad) peptidyl-prolyl cis-trans isomerase
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
pfd  Plasmodium falciparum Dd2
Brite
KEGG Orthology (KO) [BR:pfd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PFDG_00609
Enzymes [BR:pfd01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     PFDG_00609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Peptidase_M50
Motif
Structure
PDB: 

AA seq 166 aa AA seqDB search
MSKRSKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEKIGSRGKNLHYKNSIF
HRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFF
ITLVPCPWLDGKHVVFGKVIEGMNVVREMEKGRSKKWIRQKICSNN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaggagtaaagttttttttgatatatctattgacaatagtaatgctggaaga
ataatttttgaattattcagtgatataactcctagaacctgtgaaaactttagagcttta
tgtacaggtgaaaaaataggatcaagaggtaaaaacttacattacaaaaattcaatattc
catagaattattcctcaatttatgtgtcaaggaggtgatattacaaatggaaatggatca
ggaggagaatcaatatatggaagatcttttacggatgaaaattttaatatgaaacatgat
caaccaggattattatctatggcaaatgctggaccaaataccaactcatcacaattcttt
atcaccttagtaccttgcccatggttagatggtaaacatgttgtttttggaaaagttatc
gaaggtatgaatgttgttagagagatggaaaagggaaggagcaaaaagtggatacgtcaa
aagatctgtagtaataactga

DBGET integrated database retrieval system