KEGG   Plasmodium falciparum Dd2: PFDG_04269Help
Entry
PFDG_04269        CDS       T01051                                 

Definition
(Broad) hypothetical protein
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
pfd  Plasmodium falciparum Dd2
Brite
KEGG Orthology (KO) [BR:pfd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pfd03041]
    PFDG_04269
   03009 Ribosome biogenesis [BR:pfd03009]
    PFDG_04269
Enzymes [BR:pfd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PFDG_04269
Spliceosome [BR:pfd03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    PFDG_04269
Ribosome biogenesis [BR:pfd03009]
 Eukaryotic type
  90S particles
   Helicases
    PFDG_04269
  Pre-60S particles
    PFDG_04269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217
Motif
AA seq 600 aa AA seqDB search
MMDDDNDYNTMKNSNDNNLKKTKKNSIIKKKKKKKKKEILENKDSNINNLKNENYRSESE
AESESTNDSVSLNNIEEDNELNENSENNENNENDEDNKNNKNNENNENTSSEEICDHDKN
DKTYTDEIKSNNSDHNNNNSKEHFYSELKFEELNICDALKKGLKELNFVTLTEIQAKCIP
HFLSGKDILGAAKTGSGKTLAFLVPSINILYNIKFLPKNGTGVLIISPTRELCLQIYQVC
KDLCKYIPQTNGIIIGGMSRNEEKKKFIHGINILIATPGRLLDHMQNTKEFIYKNLICLI
IDEADRLLQIGFEEEINLIIKRLPKKRQTALFSATQTTKVESLIRLSLQKPIFIEVTTKI
ATVERLQQGYALVDEDKRFLLLFTFLKKNMSKKIMVFFNNCMSVQFYNDLLNYIDIPTYC
IHGKKKQNKRLKSFHDFSAAKCAILLCTNVAARGLDIPNVNYIIQYDPPDDSKEYIHRVG
RTCRGQDSNGSAIIFLMKHELKFLNYLKFYNIPINQFAYDPNKLINIQSHIQSIVTKNFH
LHKMAREAFKSYLNGYITYALKDVFEVNNLNLLLTSKNFGLEVPPKVDLNLKLNVTKKKI
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgatgataatgattataatacaatgaaaaattcaaatgataataatttgaaa
aaaaccaaaaaaaacagtataataaaaaagaaaaaaaagaaaaagaaaaaagagatttta
gaaaataaagatagtaatataaataacttaaaaaatgaaaattatagaagcgaatcagaa
gcagaaagtgaaagtactaatgacagtgtttcattgaacaatatagaagaagataacgaa
ttaaatgaaaatagcgaaaataatgaaaataacgaaaatgacgaagataataaaaataat
aaaaataatgaaaataatgaaaatacttcaagtgaagaaatttgtgaccatgataaaaat
gataaaacatacacagacgaaataaaaagtaataacagtgatcataataataacaattca
aaagaacacttttatagtgaattaaaatttgaagaattaaatatatgtgatgcattaaaa
aaaggtttaaaagaattaaattttgttacattaacagaaattcaagctaaatgcattcct
cattttttaagtggaaaagatattttaggagctgctaaaacggggtccggaaaaacatta
gcttttcttgtaccttcaataaatatattatataatataaaatttttacctaaaaacggt
acaggtgttttaataatatcacccactagagaattgtgtcttcagatttatcaagtttgt
aaagatttatgtaaatatataccacaaacgaatggaataattattggtggtatgagtaga
aatgaagaaaaaaaaaaatttattcatggaataaatattttaatagcaacaccaggaaga
ttattagatcatatgcaaaatacaaaagaatttatttataaaaacttaatatgtttaatc
attgatgaagctgatagattgttacaaattggatttgaagaagaaattaatttaattata
aagaggttaccaaaaaaaagacaaacagccttattttcagcaacacaaactacaaaagta
gaaagcttaattagactttctttacaaaaaccaatatttatagaagttactacaaaaatt
gcaaccgttgaaagattacaacaaggatatgctttagttgatgaagacaaaagatttctt
ttattatttacatttcttaaaaaaaatatgtctaaaaaaattatggtcttttttaataat
tgcatgtcagttcaattttacaatgacttacttaattatattgatatacctacatattgt
atacatggaaaaaaaaaacaaaataaaagattaaaaagttttcatgatttctcagctgca
aaatgtgccatcttattatgtacaaatgtagctgctagaggtcttgatataccaaatgtt
aattatataatacagtatgatccacctgatgattcccaaagaatatatacatagagttgg
aagaacatgtagaggacaagattcaaatggatcagccattatttttctaatgaaacatga
attgaaattcttaaattatttaaagttttataatataccaataaatcaatttgcttatga
cccaaacaaacttataaatatacaatcccatatacaatctattgtaaccaaaaattttca
tctgcacaagatggcaagagaggcattcaaatcatatttgaacgtaatataatgcatata
aattaaatgaacacaagtctgtttatctatatatatatatatatttatgtatttatatta
ttatataattatattttttttttctttcttcttagggttatataacttatgcattaaaag
acgtattcgaggtgaacaacctgaatctccttttgacttccaaaaattttggattagaag
ttccccccaaaagttgacttaaatttaaaattaaatgtcacaaaaaaaaaaatttaa

DBGET integrated database retrieval system