KEGG   Pseudomonas fluorescens F113: PSF113_1224Help
Entry
PSF113_1224       CDS       T01734                                 

Gene name
hisQ
Definition
(GenBank) HisQ
  KO
K10016  histidine transport system permease protein
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PSF113_1224 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfe02000]
    PSF113_1224 (hisQ)
Transporters [BR:pfe02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    PSF113_1224 (hisQ)
   Histidine transporter
    PSF113_1224 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Holin_9
Motif
Other DBs
NCBI-ProteinID: AEV61251
UniProt: G8PW67
Position
complement(1437316..1438044)
Genome map
AA seq 242 aa AA seqDB search
MFEQLLQNLGLSAFSLQGFGPLLMQGTWMTIKLSALSLLLSVLLGLLGASAKLSSVKLLR
IPAQLYTTLIRGVPDLVLMLLIFYSLQTWLTSFTDFMEWEYIEINPFGAGVITLGFIYGA
YFTETFRGAILSVPRGQVEAATAYGLKRGQRFRFVVFPQMMRFALPGIGNNWMVMLKATA
LVSIIGLADLVKAAQDAGKSTYQLFYFLVLAALIYLLITSASNVILRWLERRYAAGAREA
VR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaacaactcctacaaaatctggggctctccgccttcagcctgcagggctttggc
ccgctgctgatgcaaggcacctggatgaccatcaagctgtcggccctgtccctgttgttg
agcgtcttgctcggcctgttgggcgccagcgccaagctgtccagcgtcaaactgctgcga
atccctgcccagctctacaccacgctgatccgtggcgtgccggacctggtgctgatgctg
ctgattttctatagcctgcaaacctggctgacctcgtttaccgactttatggaatgggaa
tacatcgagatcaacccattcggcgccggggtgatcaccctgggcttcatctatggcgcg
tacttcaccgaaacctttcgcggcgcgatcctctcggtcccccggggccaggtcgaagcc
gccacggcctacggcctcaagcgtggccagcgctttcgcttcgtggtgtttccacaaatg
atgcgcttcgccctgccgggtattggcaacaactggatggtgatgctcaaggctaccgcg
ctggtgtcgatcatcggcctggccgacctggtcaaggcggcccaggatgcgggcaagagc
acctaccaattgttttacttcctggtactggcggcgttgatctatttgctgatcaccagc
gcgtccaacgtcatcctgcgctggcttgagcgccgttacgccgccggcgcccgggaggcg
gtgcgatga

DBGET integrated database retrieval system