KEGG   Pseudomonas fluorescens F113: PSF113_1541Help
Entry
PSF113_1541       CDS       T01734                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00521  Streptomycin biosynthesis
pfe00523  Polyketide sugar unit biosynthesis
pfe01130  Biosynthesis of antibiotics
Module
pfe_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PSF113_1541
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSF113_1541
Enzymes [BR:pfe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PSF113_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA Cupin_1
Motif
Other DBs
NCBI-ProteinID: AEV61565
UniProt: G8Q0K0
Position
1798561..1799121
Genome map
AA seq 186 aa AA seqDB search
MTDFTLQALALEGLYLIQQKVFCDDRGRFARLFCQSRLTLQGRPFAIRQINHSRTVEKGS
VRGLHYQKAGYAESKLITCIRGAVWDVVVDLRPQSPTYLQWHAEELRADDGRSLLIPAGF
AHGFQALTDDAEVLYLTDADYAPGHEAGLSVVDPALSIPWPLPVKNLSAKDASHPLLDKD
FSGVEL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttcacccttcaggcgttagcgctggaaggcttgtatctgatccagcaaaaa
gtcttctgcgatgatcgggggcgttttgcccgattgttctgtcagtcccgcctcacgctt
caggggcgtccattcgctattcgccagatcaaccattcacgtacggtcgaaaaaggtagc
gtacgaggcttgcactaccaaaaggccgggtatgcagagtccaagctgattacttgcata
cgtggcgcggtatgggatgtggtggtcgatttgagaccgcaatccccaacctacctgcag
tggcatgccgaagaactgcgagccgatgacggacgcagtttgctgattcctgccggcttc
gcccatggtttccaagcccttaccgatgacgctgaagtgctgtacctgaccgatgctgac
tacgctccgggtcatgaagccggcctttcagtcgttgaccctgcgctgtctataccctgg
ccgctgcctgttaaaaacctgtcggccaaagacgcgagtcatccgttgctggacaaagac
ttcagtggagttgagctgtaa

DBGET integrated database retrieval system