KEGG   Pseudomonas fluorescens F113: PSF113_1976
Entry
PSF113_1976       CDS       T01734                                 

Gene name
hcp2
Definition
(GenBank) Hcp2
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe02025  Biofilm formation - Pseudomonas aeruginosa
pfe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSF113_1976 (hcp2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSF113_1976 (hcp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfe02044]
    PSF113_1976 (hcp2)
Secretion system [BR:pfe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSF113_1976 (hcp2)
SSDB
Motif
Pfam: T6SS_HCP CDC37_M
Other DBs
NCBI-ProteinID: AEV61988
UniProt: G8Q6B4
Position
complement(2318202..2318702)
AA seq 166 aa
MTITDNNQILLTEKAFSADSVGNIYQEGHKDEIMVQGFQHQVTIPRDPQSGQPTGQRIHQ
PLVITKVFDRASPLLQQVLCSGEVLTKVEIKWYRTSAAGTQEHYYTTTLEDAIIVEIKDY
MLNCQDPANTHFTHLEDVHFTYRKITWTHEISNTTGSDDWRSPVVG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaccattacagacaacaatcaaatattgctgaccgagaaggcgttttccgccgactcg
gtgggtaacatttatcaggaaggccataaagacgaaatcatggtgcaaggtttccagcat
caggtgaccatcccacgagacccccagtccggtcagccaaccggtcaacgcatacaccaa
cccttggtcatcaccaaagtctttgacagagcctcaccgctgctgcagcaagtcctgtgc
agtggcgaagtcctgaccaaagttgaaatcaagtggtaccgcacttcggcggccggtact
caagagcactactacaccaccacactggaggacgcgatcatcgtcgagatcaaggactac
atgctcaactgccaagacccggcgaacacgcatttcacccatttggaagacgtacacttc
acctatcgcaagatcacttggacccacgaaatcagcaataccacgggttccgatgactgg
cgttcgcccgttgtcggttga

DBGET integrated database retrieval system