KEGG   Pseudomonas fluorescens F113: PSF113_2414
Entry
PSF113_2414       CDS       T01734                                 

Gene name
impF
Definition
(GenBank) ImpF
  KO
K11919  type VI secretion system lysozyme-related protein
Organism
pfe  Pseudomonas fluorescens F113
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfe02044]
    PSF113_2414 (impF)
Secretion system [BR:pfe02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PSF113_2414 (impF)
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AEV62423
UniProt: G8QBH6
Position
complement(2815694..2816137)
AA seq 147 aa
MAGFGLRPPLFERLASPADDTGRVFDRQALQDSVHAELSRLFNTRRGPRALTEPPSILDY
GIADWTALQQQRSDDRRQLTREIRQAITHFEPRLRLGEVEVCPVPGHPQQLCIRLLGELR
GDLHAWPVAFVIEHAGDGLEVRHERLD
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctggcttcgggctgcgcccgcccctgttcgaacgcctggccagcccggcggacgat
accggccgggtgttcgaccgacaggcgttgcaggactcggtgcatgccgaactgtcgcgc
ctgttcaatacccgacgcggcccacgggcgctgaccgaaccgccgagcatcctcgactat
ggcatcgccgactggaccgcgctgcaacagcagcgcagcgatgaccggcgtcaactgacc
cgggaaatccgccaggccatcactcacttcgaacctcgcctgcgcctgggcgaggtcgag
gtctgcccggtgccgggccatccgcagcaactgtgcatacggctgctgggcgagctgcgt
ggcgacctgcacgcatggcccgtggcatttgtcatcgagcacgccggcgacggccttgag
gtacgacatgagcgactcgattga

DBGET integrated database retrieval system