KEGG   Pseudomonas fluorescens F113: PSF113_2421
Entry
PSF113_2421       CDS       T01734                                 

Gene name
icmF3
Definition
(GenBank) IcmF3
  KO
K11891  type VI secretion system protein ImpL
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe02025  Biofilm formation - Pseudomonas aeruginosa
pfe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSF113_2421 (icmF3)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSF113_2421 (icmF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfe02044]
    PSF113_2421 (icmF3)
Secretion system [BR:pfe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSF113_2421 (icmF3)
SSDB
Motif
Pfam: IcmF-related_N IcmF_C
Other DBs
NCBI-ProteinID: AEV62430
UniProt: G8QBI3
Position
2821802..2825626
AA seq 1274 aa
MSPLSIVALVVLAIVVVLLIAALIWWLRTQGGAAIRSFYGAVRRMEQEQGTRDRYQMPWL
MMLGNESDGAQLCAQWRLQPTDKVAWFGRWFCDAEGSVLVVPQALFLPDDGMNRQRGNWW
RLLGLMLRLRSKRPLDAVIWTVPFSTLDDIEHTTELSLKVRRCFIDLLQRFGLSLPVYVV
ITGMEELPGVQELVSALPAEARESMLGWSSPYLPDAAWQSQWSDQALDQVNAALSQSIIE
IGALSGQLGTDLYGLPERFEGLRRALQILLEPVFQGNAQGEAPRCRGVYFTASQAPVVSG
DGLTAADSAQRQTVFARQLWSRRLVAERGLAQPVPRLLRLRQRGHRLVGAVALVVGLVWL
GGMVWVWHDSVEQAEGLSRLILSTHKNHLVVDPDEPQLEPTRHNVQNYWNMLEKAPSWRF
VSVVFPTSWFSSVDTQLENGLRLTARHHWILPLRDLLNSDLEQLKSIRNTERRGNVENED
PAQWQSYVKAKELVELAVRLEQHNQMFSQVVNDPKAPLDELVQLSNTALSLGLNTGTLSR
PRFYNRVLFDTQNSDLKGLDLNAARPVISDNFTGLMQRWLDHYFLADNFVRQAGYLKLHL
QRLEAGSGNSLSELEDLMALIDDLQTLVSLTNSAWGRGKGQDLVPGYSQMLDKVSHSTLL
GPDIEQDLESQAAKLQQSFRDQWIVQTGSRDNLLVQQGSGLLVLQDHVTALDGAVQALFK
RDFVALAMQKDPSGNNPDSMGQGDGSDDFSVALNYFASYKSYANEEMPRIPPDYRDALMQ
AAEGAAARAMWLSLDESDEALPGMGFNVQTAQAVALQKAFMDVHRGDLAIRFQRLLNRRA
LAQLKSGLDEIDAQPLFSQRADVQRWDGSKNFGLQLYGASDPQDLKLNLAQQFGAMLQIA
EQRMPALEWLIVQQDNLSALEHDQVARFMALNDELLKYKNQNPASSAAQLEQLVSRDFIA
MDTTSCAQILQTSSLPGGRGDLALRTVALQQGALQRCLYLQQNQAAAAWNDLANYFNQYL
AGRFPFSQDVRASDADPARVQHLLELIDTRLPLAQAGLTLSQTPERLAAEDFLNRLKQAG
TWLGPLFVRDKSGILGVEMDVRWRTDRDEERGADQVIAWSLDAGNQQISYPGGGQPNLRW
MVGQPVRLTLRWARNGYQRPANDPLQPNLVVRDLEAGWEYQGPWSLLRLMRSQVASQRQP
NVDYTDFPLALQLPVTAQTQARTAQQTLMFVRLSLMSQGSKLPLSIPPLPTRAPRSPFMA
TASSPAIATREEGL
NT seq 3825 nt   +upstreamnt  +downstreamnt
atgagccccctgagcatcgttgccctggtggtactcgccatcgtcgtggtgctgttgatc
gcggccctgatctggtggctgcgtacccagggcggggcggcgatccgcagtttctatggg
gcggtgcgccgcatggagcaggagcagggcacccgggaccgctatcagatgccctggctg
atgatgctcggcaacgaaagcgatggcgcccagttgtgcgcccaatggcgcttgcaaccg
accgacaaggtggcctggttcgggcgctggttttgcgatgccgagggctcggtgctggtg
gtgcctcaggcgttgttcctgcccgatgacggcatgaaccggcaacggggcaactggtgg
cgcctgctggggctgatgttgcgcttgcgcagcaagcggccattggatgcggtgatctgg
accgtacctttcagcacccttgacgacatcgagcacaccaccgagctgagcctcaaggtc
cggcggtgctttatcgacctgttgcaacggttcggcctcagcctgccggtgtacgtggtg
atcaccgggatggaagagctgcccggggtccaggaactggtcagcgcgctgcccgccgag
gcgcgtgaatcgatgctgggctggtcctcgccctatttgccggatgcggcctggcagtcg
cagtggagtgaccaggccctggatcaggtcaacgcggcgctgtcgcagtcgatcattgag
atcggtgcgctgtcggggcaattgggcaccgatctttatgggttgccggagcgtttcgaa
ggcttgcggcgggccttgcagatcctgctggagccggtgttccagggcaatgcccagggc
gaagcaccgcgttgtcgcggggtgtatttcactgccagccaggcgccggttgtcagcggt
gatggtttgaccgccgccgacagtgcccagcggcaaaccgtgttcgcccggcaattgtgg
tcacgacggctggtggctgagcgtggcctggcccagcctgtgccgcggctgctgcgcctg
cgccagcgcgggcatcggttggtcggcgcggtggcgttggtggtgggcctggtctggttg
ggtggcatggtctgggtctggcacgattcggtggaacaagccgaagggctgtcgcggttg
atcctcagcacccataagaaccatctcgtggtcgaccctgacgaaccgcagctggaaccg
acccgacacaacgtgcagaactactggaacatgttggaaaaggccccgagctggcgcttc
gtctcggtggtctttcctacttcgtggttctcttccgtggacacgcaactggagaatggg
ttgcgcctgacggctcggcaccattggatattgcccttgcgggacctgctcaattccgac
ctggaacagctcaagtccatccgcaacactgagcggcggggcaatgtggagaacgaagac
ccggcgcaatggcagagttatgtgaaggccaaggaactggtggagctcgcggtacgcctt
gagcagcacaaccagatgttcagccaggtggtgaacgatcccaaggcaccgctggacgaa
ctggtgcaactgagcaacaccgccttgtccctgggtctcaacaccggcaccttgagccgg
ccgcggttctacaaccgggtgctgttcgatacccagaacagcgatttgaaagggctggac
ctgaacgccgcgcgcccggtgatctccgataacttcaccggcctgatgcagcgctggctg
gaccattacttcctggcggacaacttcgtgcgccaggccggttacctcaagctgcacctg
caacggctggaggccggcagtggcaattcgttgagcgaactcgaggacctgatggcgctg
atcgacgacttgcagacgctggtcagcctcaccaattcggcctggggccggggcaagggc
caggacctggtacccggctacagccagatgctggacaaggtcagccacagcacgttgttg
gggccggatatcgagcaggacctggagagccaggcggcgaagttgcagcagagctttcgt
gaccagtggatcgtccagaccggttcacgggacaatctgctggtgcagcagggcagtggc
ctgctggttttgcaagaccatgtcacggcgctggacggtgcggtgcaggcgctgttcaag
cgtgatttcgtggcgttggccatgcagaaggatccgtcgggcaataaccccgactcgatg
ggccagggcgatggcagcgatgatttcagcgtcgccctgaactacttcgccagctacaag
agctatgccaatgaagaaatgccgcgcattccgccggattaccgtgatgcgctgatgcag
gccgccgaaggtgctgcggcccgggccatgtggttgagcctggatgaaagcgatgaggca
ttgcccggtatgggcttcaatgtacaaacggcccaggccgttgcgctgcaaaaagccttc
atggacgtgcaccgtggcgacctggcgattcgtttccaacgtctgctcaatcgccgggca
ttggcgcaactcaagagtggcctggacgaaatcgatgcccagccgctgttcagccagcgg
gccgatgtccagcgctgggacggttcgaagaacttcggcttgcaactctacggtgccagc
gatccacaggatctgaagctgaacctggcccagcaattcggcgcgatgctgcagatcgcc
gagcagcgaatgcccgcgctggaatggttgatcgtccagcaggacaacctgtcggccctg
gagcatgaccaggtggcacgcttcatggccctcaacgatgaattgctcaagtacaagaac
cagaacccggccagctcggcggcccaattggaacaattggtcagccgggactttatcgcc
atggacaccacttcctgcgcgcagatcttgcagacctccagcctgcccggcgggcgcggt
gacctggccctgcgcaccgtcgcgttgcagcagggcgccttgcaacgttgcttgtacctg
caacaaaaccaggccgcggccgcctggaatgacctggccaactatttcaatcaatacctg
gccgggcgctttccgttttcccaggacgtgcgggccagcgatgccgacccggcgcgggtc
cagcatttgctggagctgatcgacacacgcctgcccttggcccaggccgggctgacgttg
agccagacgccagagcggctggcggccgaggatttcctcaaccgtttgaaacaggccggt
acctggcttgggccgctgttcgtgcgcgacaagagtggcatccttggggtggaaatggac
gtgcgctggcgcaccgatcgcgatgaagagcgcggtgccgaccaggtgatcgcctggagc
ctggacgccggcaaccaacagatcagctaccccggcggcggccagccgaacctgcgctgg
atggtcggccagcctgtacgcttgaccttgcgctgggcccgcaacggctatcagcgtccg
gccaacgacccgctgcaaccgaacctggtggtgcgcgacctggaggccggttgggagtac
caggggccttggtcattgctgcgcctgatgcgctcgcaggtggcgagtcagcgccagccg
aatgtcgactacaccgatttccccctggccctgcaacttccggtgaccgctcagacccag
gcccgcacggcgcagcaaacgttgatgttcgtgcgcctgtcgttgatgagccagggctcc
aagctgcccctgtcgatcccgccactgccgacgcgggcgccccgttcacctttcatggcg
accgcttcgagccccgccattgccactcgtgaggagggcctgtga

DBGET integrated database retrieval system