KEGG   Pseudomonas fluorescens F113: PSF113_2461Help
Entry
PSF113_2461       CDS       T01734                                 

Gene name
phlC
Definition
(GenBank) PhlC
  KO
K22839  2-acetylphloroglucinol acetyltransferase [EC:2.3.1.272]
Organism
pfe  Pseudomonas fluorescens F113
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSF113_2461 (phlC)
Enzymes [BR:pfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.272  2-acetylphloroglucinol acetyltransferase
     PSF113_2461 (phlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt ACP_syn_III Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AEV62468
UniProt: G8QCA9
Position
complement(2883748..2884944)
Genome map
AA seq 398 aa AA seqDB search
MSARRVAIVSAAYTPKPGSSRVCQTFKEMIVESAYQALNAIKMHPRELQAVAYGYHGEGI
SEYGGLGPTISDALGISPAPTFMSTANCTSSSVSFQMAHQMVASGEYDIVLCGGFEKMTD
HINYAEYIGSSTECEYDYFLGISHTDAFALATAEYFEKFGYAGREADVLATFGRQMRIYA
HNTPTATRYGVPIPSLEALKSSEACGSMLAWGEASGCAILVAEHLAHRYTTQPVFIRGCA
YTGVSHYFGTRYHNPTLQFPGLPKDVGMAVSANSMACAEIAYKKAGITAKDIDVAQVYDL
LGAGLIQMESMGVCGPGQAGDFVLEGGIALDGQLPLNTDGGNIGRGHASGCDGILHITEL
FRQLRGESNNQVKGARIGVSQNLGGYAAHNSVIVLSND
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgacgcgttgctatcgtttcggctgcctatacccctaagcccggcagctcc
agagtttgtcagactttcaaggagatgatcgtcgagtccgcctaccaggcgctcaacgcc
atcaagatgcacccccgcgaactccaggcagttgcctatggctaccacggtgaaggcatt
tctgaatacggaggcctgggcccgaccatttccgatgccctgggtatcagccctgctccc
acgttcatgagtactgccaactgcaccagcagctcggtgtctttccagatggcccaccaa
atggtcgcctcaggtgagtacgacatcgtcctgtgcggcggcttcgaaaaaatgaccgac
cacatcaactacgccgaatacatcggctccagcactgaatgtgaatacgattattttctc
ggcatctcacacacagacgccttcgccctggcgaccgccgagtattttgaaaagttcggt
tatgctggacgcgaagcggatgtattggcaacttttgggcggcagatgcgtatctatgcc
cataacacccccacggctacccgctatggcgtgccgatcccttccctcgaagcactcaag
agtagcgaagcctgtggctcgatgttggcctggggtgaagccagcggttgcgccatcctg
gttgccgaacaccttgcgcaccgttacacgacccaaccggtctttatccgtggctgtgcc
tacaccggcgtatcgcactatttcggcacgcgctatcacaacccgacgttgcaatttccg
gggctgccaaaagatgtaggcatggcggtttccgccaactcgatggcctgcgccgaaatc
gcctacaaaaaagccggcatcactgcaaaggatatcgatgtggcgcaagtctacgacttg
ctgggcgccgggttgattcaaatggagtccatgggcgtatgtggtccaggccaggcaggc
gactttgtattggaaggcggcatcgcccttgatgggcaacttcctctgaacactgacggc
ggcaacatcggacgcggccacgcctccggttgcgatgggattttgcacattactgaattg
ttccgacagcttcgcggcgagtccaacaaccaagtcaaaggcgcccgtattggcgtttcg
caaaacctgggcggttacgccgcgcacaacagtgtcattgtgctttccaacgattaa

DBGET integrated database retrieval system