KEGG   Pseudomonas fluorescens F113: PSF113_2885
Entry
PSF113_2885       CDS       T01734                                 

Gene name
vgrG1b
Definition
(GenBank) VgrG1b
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSF113_2885 (vgrG1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfe02044]
    PSF113_2885 (vgrG1b)
Secretion system [BR:pfe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSF113_2885 (vgrG1b)
SSDB
Motif
Pfam: Phage_GPD Gp5_C Phage_base_V DUF2345 bCoV_SUD_C
Other DBs
NCBI-ProteinID: AEV62889
UniProt: G8Q200
Position
3396141..3398366
AA seq 741 aa
MAITQNNRLVQVDSPLGGDVLLLQSMEGSEELGRLFHYELDLTSEDRAITFDQLLGKPMG
LTLELYDGGKRYFHGIVCSCRQLTGHGQFAGYRVSLRPWFWLLTRTSDCRIFQNKTVPDI
IKQVFRDLGFSDFEDSLSGSYREWEYCVQYRETSFDFVSRLMEQEGIYYYFRHEEARHVL
VLADAYGAHTTAPDYASVPFYPPDRQMRERDHFYDWQLAREVQPGSLALNDYDFLRPRAS
LEVRSSVPRNHTNADYPLYDYPGEYVQSNDGDHYARTRIEAIHSQFERVQLRGRARGIGC
GHVFTLTGYDRADQNREYLVVAARYQIRQDAYESGQFDVDEQFVSELDCMDASQVFRPLP
LTPMPIVRGPQTAVVVGPSGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSVQLPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYGLPANATQSGVKSRSSKGG
SPANFNEIRMEDKKGSEQLFIHAEKNQDIEVENDETHWVGHDRRKTIDNDETVHVKHDRT
ETVDNNETITIGVDRKEKVGNNETISIGVNRTEDVGSNEKITIGANRTENVGSNETITIG
ADRTEKVGANEKITIVSNRTEDVGGNETIGITGNRNETVQGNEGIEISGNQSTQIGQNES
RDVAQNRTTNIKQNDSLDVGKHFSLTAGDSISLTTGDASITMKKDGTIMISGKNITIDGS
GAIKIKASKNVVVKGQKILQN
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggcaatcacgcaaaacaaccgtttggtgcaggtcgacagtcctctcggcggcgatgtc
ctgttgttgcaaagcatggaaggcagcgaagagctggggcggttgtttcactacgaattg
gacctgacctccgaagaccgggcaatcacgttcgaccagttgctgggcaagccgatgggc
ctgaccctggagctgtacgacggtggcaaacgctacttccacggcattgtctgcagttgt
cggcaactgaccgggcacggccagttcgccggttatcgcgtcagtctacggccctggttc
tggctgcttacgcgcacctccgactgccggattttccagaacaagaccgtgccggacatc
atcaagcaggtgttccgcgacctcggtttctccgatttcgaggacagcctgagcggcagc
taccgcgagtgggaatattgcgtgcagtaccgcgaaaccagcttcgatttcgtcagccgg
ttgatggagcaggaaggcatctattactactttcgccatgaagaggcgcgtcatgtgttg
gtgttggccgacgcctatggcgcccacaccacggcacccgactatgcctcggtgcccttc
tatccgcctgatcggcaaatgcgcgagcgcgatcatttctacgactggcaactggcgcgg
gaagtccaacccggctcgctggcgctgaacgactatgacttcctgcgcccgcgcgccagt
cttgaggtgcgctccagcgtgccgcgaaaccacaccaacgccgactacccgctctacgac
tacccgggtgaatacgtccagagcaacgatggcgatcactacgcgcggacccgcatcgag
gccattcacagccagttcgagcgtgtgcaattacgcggccgcgcccgcggcatcggttgc
ggtcatgtgttcacgctgacggggtacgaccgtgctgaccagaaccgcgagtatctcgtg
gtggccgcccgttatcagattcgtcaggatgcctatgaaagcggccagtttgacgtcgac
gaacagttcgtcagcgagctggactgcatggatgccagccaagtcttccgccctctgccc
ctcacgcccatgcccattgttcgcgggccgcagactgccgtggtggtcggccccagtggc
gaggagatctggaccgaccaatatggccgggtcaaagtgcatttccactgggatcgccat
gaccagtccaacgaaaacagctcctgctggattcgcgtgtcccaggcctgggccggcaag
aactggggatccgtacagctcccgcggatcggtcaggaagtgatcgtcagtttcctcgag
ggcgatccggatcggccgattatcactggccgcgtctacaacgctgaacagaccgtgccc
tacggattgccggccaatgccacccagagcggggtgaaaagccgttcaagcaagggcggt
tcaccggccaacttcaatgaaatccgcatggaggacaagaaaggctccgagcagctgttt
atccacgccgaaaaaaaccaggacatcgaggtcgagaacgacgagacccactgggtgggc
cacgaccgccgcaagaccatcgacaacgacgagaccgtacacgtcaaacatgaccgcacc
gaaaccgtcgacaacaacgaaaccatcaccatcggtgtggatcgcaaggaaaaggtcggc
aataacgaaaccatctccatcggtgtgaaccgcaccgaggatgttggcagcaacgagaaa
atcaccattggcgccaatcgcaccgagaacgtgggcagtaacgagaccatcaccatcggc
gcagaccgcacggaaaaggtcggtgccaacgaaaaaatcaccatcgtcagcaaccgtacc
gaggacgtgggcggcaacgagaccatcggcatcaccggcaaccgtaacgaaacggtccag
ggcaacgaaggcatcgagatcagcggtaaccagagcacccagatcggccagaacgaatcc
cgcgacgtcgcccagaaccgcaccaccaacatcaagcagaacgacagcctggacgttggc
aagcacttctcccttaccgccggcgactccatcagcctgacgacgggtgacgccagcatc
accatgaagaaggacggcacgatcatgatcagcggcaagaacatcaccatcgacggctcc
ggcgccatcaagatcaaggccagcaagaatgtggtcgtcaaaggccagaaaattctgcag
aactag

DBGET integrated database retrieval system