KEGG   Pseudomonas fluorescens F113: PSF113_3350Help
Entry
PSF113_3350       CDS       T01734                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00071  Fatty acid degradation
pfe00072  Synthesis and degradation of ketone bodies
pfe00280  Valine, leucine and isoleucine degradation
pfe00310  Lysine degradation
pfe00362  Benzoate degradation
pfe00380  Tryptophan metabolism
pfe00620  Pyruvate metabolism
pfe00630  Glyoxylate and dicarboxylate metabolism
pfe00640  Propanoate metabolism
pfe00650  Butanoate metabolism
pfe00900  Terpenoid backbone biosynthesis
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
pfe01212  Fatty acid metabolism
pfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSF113_3350
   00630 Glyoxylate and dicarboxylate metabolism
    PSF113_3350
   00640 Propanoate metabolism
    PSF113_3350
   00650 Butanoate metabolism
    PSF113_3350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSF113_3350
   00072 Synthesis and degradation of ketone bodies
    PSF113_3350
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSF113_3350
   00310 Lysine degradation
    PSF113_3350
   00380 Tryptophan metabolism
    PSF113_3350
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSF113_3350
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSF113_3350
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSF113_3350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfe04147]
    PSF113_3350
Enzymes [BR:pfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSF113_3350
Exosome [BR:pfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSF113_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEV63351
UniProt: G8Q8Q8
Position
complement(3943406..3944590)
Genome map
AA seq 394 aa AA seqDB search
MKHSDIFVVSAVRSAIGSFGGSLKDVPPIDLATEVSRAAIERSGLAPEHIGHAVMGHVIP
TEARDAYISRAVAMNAGLTKETPAFNVNRLCGSGLQAIVSAAQSLMLGDAGAALAGGVES
MSRGAYLLPQARWGARMGNVLAIDYMLGVLQDPFAGFHMGITAENIAEHYGITRQTQDEL
ALLSQQRAARAIAEGRFSGQIVPIEVATRKGPVSFATDEHVRAEVDAEQLSRMKPAFKKD
GSVTAGNASGLNDGAGALILATGQTVHEQGLKPLARLVGYAHAGVEPSMMGLGPIPATRL
VLERAGLSVADLDVIEANEAFAAQACAVAQELGFDPQKVNPNGSGISLGHPVGATGAIIA
TKAIHELHRCQGRYALATMCIGGGQGIAVLFERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattccgatatttttgtcgtgagcgccgtccgttctgccattggcagctttggc
ggctcgctcaaggacgtgccgcctattgacttggcaaccgaggtttcccgcgccgctatc
gaacggtcaggcctggcgcccgaacacatcggccatgcggtgatgggacatgtgatcccg
accgaggcacgtgatgcctacatctctcgggctgtcgcaatgaatgccggcctgacgaaa
gaaacccccgccttcaacgtcaaccgcctttgcggttcgggtctccaggccattgtcagt
gccgcgcaaagcttgatgctcggagacgcgggtgctgcgctggccggtggcgtcgagtcc
atgagccggggggcgtatttgttgccgcaggcgcgctggggggcacgaatgggcaacgtg
ctggccatcgactatatgcttggggtattacaggacccatttgccggtttccatatgggt
atcactgctgaaaatatcgccgagcactatggcatcacgcgtcagacccaggatgaactg
gcgcttctgagccagcagcgggctgcccgggcgattgccgaagggcgtttttccgggcaa
atcgtgccgatcgaagtcgcgacccgcaaagggcctgtttcgtttgcgacggatgagcac
gtacgggccgaggtcgacgccgagcaattgagtcgcatgaagccggccttcaagaaggat
ggcagcgtcaccgctggcaacgcgtctggcctcaatgatggtgccggcgcactgatcctg
gccacgggccagactgttcacgaacaaggcctcaagcccctggcgcgactggtaggttat
gcccacgccggcgttgaaccttcgatgatggggttgggaccgattcccgccacccgcctg
gtgctcgaacgtgccggcctgagcgtcgccgacctcgatgtaatcgaggccaacgaagcc
tttgccgcccaggcctgtgccgtagcgcaagaactgggcttcgatccgcagaaggtcaac
cccaacgggtcgggcatctcgctgggccatcctgtgggcgccactggcgcgatcattgcc
accaaagccattcacgaactgcatcgctgtcaaggccgttatgccctggcgaccatgtgt
attggcggcggccaaggcatcgccgtgttgttcgaacgggtttga

DBGET integrated database retrieval system