KEGG   Pseudomonas fluorescens F113: PSF113_3539Help
Entry
PSF113_3539       CDS       T01734                                 

Definition
(GenBank) Sarcosine oxidase alpha subunit
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00260  Glycine, serine and threonine metabolism
pfe00630  Glyoxylate and dicarboxylate metabolism
pfe00670  One carbon pool by folate
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSF113_3539
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSF113_3539
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PSF113_3539
Enzymes [BR:pfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     PSF113_3539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T DUF1989 GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AEV63539
UniProt: G8QAP3
Position
complement(4159334..4161676)
Genome map
AA seq 780 aa AA seqDB search
MHAPRVSHPREPGLFARAPTLERYRVAAGGLTLVALQPGDSLQVINLEGQQPCELLAVDA
NGRSALAAWALSGSAACGFIGARLAEPTVQARRINQALSRRGVEPYQLPSAASLWDEDSP
ADFSRHFVASDELLVIVAAPAGPTSVDRQYRPSELRLWVTRANPSALLLPALPEPLGELL
DEFTIHAGTAHSYTVGKGQYVQVLDVAGRQCSDFVALDRRALDRGLELELDQTVTRTLNG
SAYPAPGLFSKFFDRQMQPMLEVVRDTVGRHDSFALACAARYYESHGYFGHDNCSDNLSR
ALAPHGVEARSGWPAINLFFNTGIDAHQQMTLDEPWSRPGDYVLLRAMTDLLCGSTSCPD
DIDPANGWNPTDIQVRIYSEKERFSIAMSTRTTADADPILTRESAFHSRTSALTGSFTDY
RNWWLPLRYDGYGAIEEYLGCRERVAVMDLTALRKFEIIGPDAEALLQYCLTRDVRRLAV
GQVVYSAMCHEHGGMLDDGTLLRLGPDNFRWICGEDYAGVWLREQAQKLGMKVWVKSASE
QIHNLAVQGPMSRELLKQMVWTPATQPSLETLGWFRFLVGRLDGYDGCPLMISRTGYTGE
LGYEVWCQPEDAERVWDRIWKLGQPLGLVPLGLEALDMLRIEAGLIFAGYEFSDQTDPFE
AGIGFSVPMKSKTDDFIGRDALLRRSAHPAHKLVGLQLSGNEAAHHGDPVYRGLAQVGVI
TSACRSPLLASNIALCRVDVACADVGTTLEIGKVDGLQKRISAEVTAAIFYDPEKSRVRS
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcacctcgtgtctctcacccccgggagcccggactgtttgcccgggcgccgacc
ctggagcgctatcgggtagcggccggcggcctgacgctagtggccttgcagcccggggac
agcctgcaagtgatcaaccttgaaggacagcaaccctgcgaactgctggccgtggacgcc
aacggtcgcagcgcgctggcggcctgggcattgagcggttcggcggcctgcgggttcatc
ggcgcacggctcgccgagccaaccgtgcaagctcggcgtatcaaccaggcgctgagccgg
cgcggcgttgagccataccaattgcccagcgcagcttcgctctgggacgaggacagtcct
gccgacttcagtcgccactttgtcgccagcgatgaactgctggtgattgtcgctgcaccc
gcgggccccacgtccgtcgatcgacagtaccggcccagcgaactgcggttgtgggtgacc
cgggccaatccctcggcgctgctgctcccggcactacccgaaccgttgggcgagttgctc
gacgaattcacaattcacgccggtaccgcccacagttacaccgtcggcaaagggcagtac
gtgcaggtgctggacgtcgccggtcgccaatgctcggacttcgtcgccctcgatcgacgg
gcactggatcgcggcctggagctggagctggaccagaccgtcacccgcaccttgaacggc
agcgcctaccccgctccgggactgttctcgaaatttttcgatcggcagatgcagccgatg
ctggaggtggtgcgtgacaccgtgggccgccacgactccttcgccctggcctgcgccgcg
cgctactacgagagccatggctacttcgggcacgacaactgcagcgacaacctgagccgg
gccctggcgccccatggggtcgaggcgcgcagcggttggccggcgatcaatttgttcttc
aacaccgggatcgacgcccaccagcagatgacgctcgacgagccctggtcgcgtcccggt
gattacgtgctgctgcgggccatgaccgatctgctgtgtggcagcacctcatgcccggat
gacatcgacccggccaacggctggaacccgaccgatatccaggtccgcatctacagcgaa
aaggagcgtttttccatcgccatgagcactcgaaccacggccgatgccgacccgatcctc
acccgtgagtccgcgttccactcacgcaccagcgccttgaccggcagctttaccgactac
cgcaattggtggctgccgctgcgctacgacggctatggcgccatcgaggaatacctcggt
tgccgtgaacgcgtcgcggtgatggacctgaccgccctgcgcaaattcgaaatcatcggc
cccgacgccgaagccttgctgcagtactgcctgactcgggatgtgcggcgcctggcggtg
ggtcaagtggtgtactcggcgatgtgccacgaacacggcggcatgctcgacgacggcacc
ctgctgcgcctgggcccggacaatttccgctggatctgcggcgaggattacgccggggtc
tggctgcgcgaacaggcgcaaaagctcggcatgaaagtctgggtcaaatccgccagcgaa
cagattcacaacctggccgtccagggcccgatgagccgtgaactgctcaagcagatggtc
tggacccctgcgacccaaccgagcctggaaaccctgggctggttccgattcctggtgggc
cgcctggacggttacgacggctgcccgctgatgatctcgcgcaccggctacaccggcgaa
ctgggctacgaagtctggtgccagcccgaagacgccgagcgggtctgggaccgtatctgg
aaactgggccagccgttgggcctggtgccgctgggcctggaagcgctggacatgctgcgc
atcgaagccgggctgattttcgccggctacgagttcagcgaccagaccgatcctttcgag
gcgggtatcggcttttctgtgccgatgaaaagcaaaaccgacgacttcatcggccgcgat
gcgctgttacggcgcagcgcccaccccgcccacaagctggtgggcctgcaactgagtggc
aacgaagccgcccaccacggtgacccggtgtatcgcggcctggcccaggtcggggtcatc
accagtgcctgccgctcgccgctgctggccagcaacatcgcgctgtgccgggtcgatgtg
gcctgcgccgacgtcggcaccacgcttgagatcggcaaagtcgatggcctgcagaagcgc
atcagcgccgaggtcaccgcagcgattttctacgacccggaaaagagccgggtgcgtagt
tga

DBGET integrated database retrieval system