KEGG   Pseudomonas fluorescens F113: PSF113_4198Help
Entry
PSF113_4198       CDS       T01734                                 

Definition
(GenBank) aminotransferase, class I and II
  KO
K16423  (S)-3,5-dihydroxyphenylglycine transaminase [EC:2.6.1.103]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00261  Monobactam biosynthesis
pfe01055  Biosynthesis of vancomycin group antibiotics
pfe01100  Metabolic pathways
pfe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    PSF113_4198
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    PSF113_4198
Enzymes [BR:pfe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.103  (S)-3,5-dihydroxyphenylglycine transaminase
     PSF113_4198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: AEV64198
UniProt: G8Q2A4
Position
4924405..4925661
Genome map
AA seq 418 aa AA seqDB search
MSSAFENTIFDDPILNVIHLLNSIAQENPEAISLASGRPDDKQCDPSLIDKGLAHYKNHV
AGTDQSLATLLCQYGKTSGIINEIIATYLQVDEAINVSNPESIVVCMGFQEACTLTLLSI
FEGGGVLLVPDPVFSGITGIAKLLGIKIVPVPMTVFLDPIALRRLIEALESRGERIKALY
AIADFSNPTADSLSHDDRRAMLSLANEKNFFILEDTAYRYFRYEGDAIASMKSIDSRRVF
LLGSFAKSIFPGLRMGYVVAPEGTGVMSFSGRLCKAKSLITVNTPAVCQAVVAGLLIEHN
YSLKGLNQPRVLSYTKKRNHMLECLEREFPLKVGAQRAVSWNHPAGGFFINLQLPFVFGY
SEMRECAKLFKVIVFPTSLFSLMNEATTQVRLSFSNATTSEITQAIGRFKAYIEFRLQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagcgcattcgaaaacacgatattcgacgaccccatcctgaacgtcatccacctt
ctgaattccattgcccaagaaaacccggaggccatttcactggcctccggtcgccccgat
gataaacagtgcgacccttcgctcatcgacaagggcctggcccactacaaaaatcacgtt
gccggcaccgaccagtcacttgcgacgctgctttgccaatatggaaaaacctctggaatc
atcaatgaaataatcgccacctatttgcaggtggatgaagcaatcaacgtttccaatcct
gaaagcattgtggtgtgcatgggctttcaagaagcctgcaccttgacgctcctgtccatt
tttgaaggcggtggggttttattggtacctgacccggtgttttccgggatcacggggatc
gcaaaactgctgggtataaaaatagtccctgtgcccatgacggtctttcttgatccgatc
gccctgcgcaggctcattgaagcgctggaatccagaggtgaaagaatcaaggcactctat
gcaattgcggactttagcaatcctaccgccgacagcctttcccatgacgacaggagagcc
atgctctccttggccaatgaaaagaactttttcatcctcgaagacacggcctaccgttac
ttcagatacgaaggcgatgccattgcgtccatgaagtccatcgacagccgtcgggtgttc
ttgctgggctcctttgccaaatcgattttcccgggcttgcgcatgggctatgtggtcgcc
ccagagggcactggggtcatgtccttcagcggcagattgtgcaaggccaaaagcctgatc
acggtgaatacccccgccgtgtgccaagcggttgtcgcaggcttgctgatcgagcacaac
tactcgttgaaagggctgaaccaacccagggtgttgtcttatacaaagaaaagaaatcac
atgcttgaatgccttgagcgcgaatttccactcaaggtcggcgctcaaagagcggtcagc
tggaatcatccggcaggcggcttcttcatcaatctgcagctgcctttcgtctttggatat
tctgaaatgcgcgaatgcgccaagctgttcaaggtgattgtatttcccaccagcttgttt
tcgctgatgaatgaggccactacccaggtcaggctgtcgttcagcaatgcaaccacctca
gaaatcacccaagcgataggccgtttcaaggcatacattgagttcaggctgcagtaa

DBGET integrated database retrieval system