KEGG   Pseudomonas fluorescens F113: PSF113_4243Help
Entry
PSF113_4243       CDS       T01734                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00020  Citrate cycle (TCA cycle)
pfe00190  Oxidative phosphorylation
pfe00650  Butanoate metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
Module
pfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pfe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSF113_4243
   00650 Butanoate metabolism
    PSF113_4243
  Energy metabolism
   00190 Oxidative phosphorylation
    PSF113_4243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AEV64239
UniProt: G8Q3B8
Position
complement(4972131..4972499)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYVVANPGIGYAQWHELFANNWMRIF
SLLALVALGAHAWVGMWTIATDYLTPMAFGKSATAVRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaacgtcacgaacctttcgcgttcgggcctctacgactggatggcccagcgt
gtgtctgcggtcgttctcgcggcttacttcattttcctgatcggatatgtcgtggcaaac
cctggcattggctacgcccaatggcatgaactgttcgcaaacaactggatgcgcatcttc
agtctgctggcccttgtcgcactgggcgctcacgcctgggtcggtatgtggaccatcgcg
accgactacctgacgccaatggcgttcggcaagtcggcgactgccgtacgtttcctcttc
caggcagtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system