KEGG   Pseudomonas fluorescens F113: PSF113_4553Help
Entry
PSF113_4553       CDS       T01734                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00450  Selenocompound metabolism
pfe00970  Aminoacyl-tRNA biosynthesis
pfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PSF113_4553
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSF113_4553
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfe01007]
    PSF113_4553
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfe03016]
    PSF113_4553
Enzymes [BR:pfe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PSF113_4553
Amino acid related enzymes [BR:pfe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PSF113_4553
Transfer RNA biogenesis [BR:pfe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PSF113_4553
 Prokaryotic type
   Other AARSs
    PSF113_4553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AEV64543
UniProt: G8Q6W6
Position
5308174..5310219
Genome map
AA seq 681 aa AA seqDB search
MSEPRKILVTSALPYANGSIHLGHMLEYIQTDMWVRFQKHRGNQCIYVCADDAHGSAIML
RAEKEGITPEQLIANVQAEHSADFAEFLVDFDNFHSTHAEENRELSSQIYLKLRDAGHIA
TRSITQYFDPEKKMFLADRFIKGTCPKCGTEDQYGDNCEKCGATYAPTDLKDPKSAISGA
TPVLKDSQHFFFKLPDFQQMLQAWTRSGTLQDAVANKIAEWLDAGLQQWDISRDAPYFGF
EIPDEPGKYFYVWLDAPIGYMASFKNLCNRTPELDFDAFWGKDSTAELYHFIGKDIVNFH
ALFWPAMLEGAGFRKPTGINVHGYLTVNGQKMSKSRGTFIKARTYLDHLSPEYLRYYYAA
KLGRGVDDLDLNLEDFVQKVNSDLVGKVVNIASRCAGFIHKGNAGVLVAGNAAPELTDAF
LAAAPSIAEAYESRDFARAMREIMALADRANAWIADKAPWSLAKQEGKQDEVQAICALGI
NLFRQLVIFLKPVLPLLAADAEAFLNVAPLTWNDHQTLLSNHQLNAFKPLMTRIDATKVQ
AMTDASKEDLAASQTDTGAPAGNGELAKDPLSPEIDFDAFAAVDLRVALIVKAEAVEGAD
KLLRLTLDIGDEQRNVFSGIKSAYPDPAKLEGRLTMMIANLKPRKMRFGISEGMVMAAGP
GGEEIYLLSPDSGAKPGQRIK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagccacgcaagatcctcgtcaccagcgccctgccctatgccaatggttcgatt
cacctcggccatatgctggagtacatccagaccgatatgtgggtgcgcttccagaagcat
cgcggcaaccaatgcatttatgtctgcgccgacgacgcccacggttcggccatcatgctg
cgcgcggaaaaggaaggcatcaccccggaacaactgatcgccaacgtccaggccgaacac
agcgccgactttgccgagttcctggtggacttcgataacttccactccactcacgccgaa
gaaaaccgtgagctgtcgagccagatctacctgaagctgcgtgacgccgggcacatcgcc
acccgttcgatcacccagtatttcgacccggaaaagaaaatgttcctggccgaccgcttc
atcaagggcacctgcccgaaatgtggcactgaagaccagtacggcgataactgcgaaaaa
tgcggcgccacctacgcaccaaccgacctgaaagacccgaaatcggcgatttccggggcg
acgccggtgctcaaggactcccagcatttcttcttcaagctgccggacttccagcagatg
ctgcaagcctggacccgcagcggcaccctgcaggacgccgtcgccaacaagatcgccgaa
tggctcgatgccggcctgcagcagtgggacatttcccgcgatgcgccgtacttcggcttc
gagatccccgacgagcccggcaagtatttctacgtgtggctggacgctccgatcggctac
atggcgagtttcaagaacctctgcaaccgcacgccggagctggacttcgacgcgttctgg
ggcaaggactccaccgccgagctgtatcacttcatcggcaaggacatcgtcaacttccac
gcgctgttctggcccgccatgctcgaaggtgccggcttccgtaagccgaccggcatcaat
gtccacggctacctgaccgtcaacggccagaaaatgtccaagtcccgcggcaccttcatc
aaggcccggacctacctggaccacctgtccccggaatacctgcgttactactacgcggcc
aagctcggccgcggcgtcgacgacctggacctgaacctcgaagacttcgtgcagaaggtc
aactccgacctggtgggcaaggtcgtcaacattgccagccgttgcgccgggttcatccac
aagggcaacgccggggtcctggtcgccggcaatgccgcgccggaactgaccgacgccttc
ctggcggccgcgccaagcatcgccgaagcctacgagtcccgcgattttgcccgtgccatg
cgcgaaatcatggccctggccgaccgcgccaatgcctggatcgccgacaaggcgccctgg
tcgctggccaagcaggaaggtaaacaggacgaagtccaggcgatctgcgccctgggcatc
aacctgttccgtcaactggtgattttcctcaagccggtgctgccgctgctggctgccgat
gccgaggcgttcctcaacgtcgcgccactgacctggaacgatcaccagacgctgctgagc
aaccatcagttgaacgcgttcaagccgttgatgactcgtatcgacgcgaccaaggtgcaa
gccatgactgacgcctccaaggaagacctggccgccagccagaccgacaccggcgcgcct
gccgggaacggcgaactggccaaggacccgctgtcgccggaaatcgacttcgacgccttt
gccgccgttgacctgcgcgtggcgctgatcgtcaaggccgaggccgtcgaaggcgccgac
aagctgctgcgcctgaccctggacatcggcgacgagcaacgcaacgtgttctccggcatc
aagagtgcctacccggacccagccaagctcgaaggccgcttgacgatgatgatcgctaac
ctcaagccgcgcaaaatgcgctttggcatctccgagggcatggtgatggcggcaggcccc
ggcggcgaggaaatctacctgttgagccctgacagcggcgccaagccgggccagcggatc
aagtaa

DBGET integrated database retrieval system