KEGG   Pseudomonas fluorescens F113: PSF113_5792Help
Entry
PSF113_5792       CDS       T01734                                 

Gene name
icmF1
Definition
(GenBank) IcmF1
  KO
K11891  type VI secretion system protein ImpL
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe02025  Biofilm formation - Pseudomonas aeruginosa
pfe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSF113_5792 (icmF1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSF113_5792 (icmF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfe02044]
    PSF113_5792 (icmF1)
Secretion system [BR:pfe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSF113_5792 (icmF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C AAA_10 Bax1-I AAA_22
Motif
Other DBs
NCBI-ProteinID: AEV65766
UniProt: G8Q710
Position
complement(6672386..6675886)
Genome map
AA seq 1166 aa AA seqDB search
MKAFFSFMTRWVIPLLGLIALSLIIWFVGPLLDWLVPEGRRWALIILVFAVWIAYRVLRI
IQARRQAAEVMRSLAAQTPPDPTSIATAEELETLRQRMDEALALLKKAKLGGDERRNLYE
LPWYVIIGPPGSGKTTALVNSGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAG
RYTTQDSDATIDKAAWLGFLGLLKKQRARRPIDGAFIAISLSDLLLGSDAERAAHAAAIR
LRIQELYTQLGVRFPIYLMLTKLDLVPGFMEYFDTLSKEERAQVWGMTFALDDGKSSDSP
LAHLQSEFTGLEQRLNDRLVERLQQERDPARRDLIYGFPQQFGALKDCLQSFLEGVFKPN
AFEERVLLRGVYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIEKLFTAV
AFAERGLVGVDPKVERRRKWIARGVLASTVVLVLVVSTLWWVSYRANQAYIAQVDQKVAP
LGQTVQNLSPAQRDVLAVLPLLNAVKHLADDAPSWAEGLGLYQGDMLEAESGSVYRKLLI
AVFAPRLLTRIEEQLHSGGNSDFLYEGLKAYLMLADTEHYDADFIKAWIALDWDRSLPRD
LPAEQRQALTAHLQALFERRPPLARLDARLVEDLRRQLQQLPVAQRVYDRIKRQKLPEGI
PDFRINEAAGRDAALVFSRKSGKPLGEPLSGFFTVKGYRQGFLLTSLSQTGTLAEEQWVL
GHEEADQQNVASLAADVRRLYFQDYLRQWDALLADIDFVPITSVAQAADVLRVISGPTSP
LKKLLVAVAKETDLQQDERLLAAQGAPVEGGVDKLKERLGSLLGQEQATQNAPAQSDDPI
TAHFAELNSIVSKSEGEPAAIDGLLADMNALYVQVSAMVGASGDALLGEAKNQATAAATR
VSLNAERQPPLVQGLVKSVVNSTTNSMMGGVRNQLNAAWTSEVVNIYRQSLAGRYPMSPG
SARDATLDDFGQFFGVGGVMDNYFRKYLQPYVDTSTPTWRWQPGAAQKLGIAPGVLQTFQ
RAATIRDAFFRSGGTQPMVRFELKPVAMDSTITQFLLDLDGQQLSYDHGPSRPTAMQWPN
PGSIGVVRISIMPPSSSGRSGITLDGPWAWFRLLEQSDLTAGNSPDRFNLRLRVDGASAS
YELRANSAFNPFKSRVLSGFSLPERL
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcgtttttcagttttatgacccgctgggtcatcccattgctggggctgatcgcc
ctgagcctgatcatctggttcgttggcccgctcctcgattggctggtgcccgaaggccgc
cgctgggccttgatcatcctggtgtttgcggtatggatcgcctaccgggtattgcgcatt
atccaggcgcgccgtcaggccgccgaagtgatgcgcagcctggccgcgcaaaccccaccg
gacccgaccagcatcgccaccgccgaggagctcgaaaccctgcgccagcgcatggacgaa
gccttggccctgctcaagaaagccaagctgggcggtgacgagcgccgcaacctctacgag
ctaccgtggtacgtgatcatcggcccgccgggttcgggcaagaccaccgcgctggtcaat
tccgggctgcatttcccactggccgcgcaactgggcgccggtgccgtacgcggtgtcggc
ggtacacgcaattgcgattggtggttcaccgaccaggcggtcctgctcgacaccgccggc
cgctacaccacccaggacagcgacgcgaccatcgacaaggccgcctggctgggcttcctt
ggcctgttgaaaaaacaacgggcccggcgcccgattgatggcgcgttcatcgccatcagc
ctgtccgacctgctgctgggcagcgacgccgagcgcgccgcccatgccgccgcaatccgg
ctgcggatccaggagctgtacacccaactgggcgtgcgcttcccgatctacctgatgctg
accaagctcgacctcgtgcccggattcatggagtatttcgataccctgagcaaggaagag
cgcgcccaggtctggggcatgaccttcgccctggacgatggcaagagcagcgacagcccg
ctggcgcacctgcaaagtgagttcaccggccttgagcagcgcctcaacgaccgcttggtg
gaacgcctgcaacaagagcgcgacccggcgcggcgcgatctgatctacggtttcccgcag
cagttcggcgccttgaaagattgcctgcaaagcttcctcgaaggcgtgttcaaacccaac
gccttcgaagagcgtgtgttgctgcgcggcgtgtatttcaccagtggcacccaggaaggc
agcccgatcgatcgcctgatcggctccatggcccagagcatgaacctggatcgtcagcac
ctggcgcgccagaccggcaccgggcgcagctacttcatcgaaaaactcttcaccgccgtg
gccttcgccgagcgcgggctggtgggcgtcgatccgaaagtcgagcggcggcgcaagtgg
atcgcccgcggcgttctggcctccaccgtggtgttggtgttggtggtcagcacgttgtgg
tgggtcagctaccgcgccaaccaggcctacattgcccaggtcgaccagaaggtcgcgcca
ttggggcaaaccgtgcagaacctcagcccggcgcaacgcgacgtcctcgccgtgttgccg
ttgctcaacgccgtgaaacatcttgctgacgacgcaccgagctgggccgaaggcctgggc
ctttaccagggcgacatgctcgaagccgagtccggcagtgtctatcgcaagctgctgatc
gcagtgttcgcgccacgcttgctgacgcgcatcgaagagcaactgcacagcggcggcaat
tcggatttcctctacgaaggcctgaaggcctacctgatgctcgccgacaccgagcattac
gatgccgacttcatcaaggcctggatcgccctggattgggaccgcagcctgccacgggat
ttgccggccgagcaacgccaggccctgaccgcgcatttgcaggcgctgttcgagcggcgt
ccgccactcgcgcgcctcgatgctcgcctggtcgaagacctgcgccgccagttgcagcaa
ttgccggtggcccagcgggtctacgaccggatcaagcgccagaaactgcctgaaggcatc
ccggacttccgcatcaacgaagccgccgggcgtgatgcggcgctggtgttcagccgcaag
agcggcaagccattgggcgagccgctgagcgggttcttcaccgtcaagggctatcgccag
ggcttcctgctcaccagcctgagccagaccggcaccctggccgaagagcaatgggtgctg
ggccacgaagaggccgatcagcagaacgtcgccagcctggccgccgatgtgcgtcgcctg
tacttccaggattacctgcgccaatgggacgccttgctggccgacatcgactttgtgccg
atcaccagcgtggcccaggccgccgatgtgctgcgggtgatttccggcccgacctcaccg
ttgaaaaagctgttggtggcggtggcgaaggaaaccgacctgcaacaggatgaacgcctg
ctggccgcccaaggtgcgccggtagaaggcggtgtggacaaactcaaggaacgcctgggc
agcttgctcggccaggagcaggcgacgcaaaacgcgccggcgcaaagcgatgacccgatc
accgcgcacttcgccgagctcaacagcatcgtcagcaaaagcgaaggcgagccggcggcc
atcgacggcttgctggcggacatgaacgctttgtacgtgcaggtcagcgccatggtcggt
gccagcggcgacgccttgctcggcgaagccaagaaccaggccacggccgccgctacgcgc
gtcagcctcaacgccgaacgccagccgccgctggtgcagggcttggtcaagtcggtggtc
aactccaccaccaacagcatgatgggcggggtgcgcaaccaactgaacgccgcctggacc
agcgaagtggtgaacatctatcgccagtccctggccgggcgctatccgatgtcgccaggc
agtgcgcgggacgcgaccctggatgacttcggccagttcttcggcgtcggcggggtgatg
gacaactacttccgcaagtacctgcaaccctacgtcgacacctcgaccccaacctggcgc
tggcagccgggcgcggcgcagaagctcggtatcgcccctggcgtgctgcagaccttccag
cgcgcggcgaccatccgcgatgcgttcttccgttccggcggcacgcagccgatggtccgt
ttcgagctcaagccggtggcgatggactcgaccatcacccagttcctgctcgacctcgac
ggccagcaactgagctacgaccacggcccaagccgcccgaccgccatgcagtggccgaac
ccgggcagcatcggcgtggtgcggatatcgatcatgccgccgtcgtccagcggtcgctca
ggcatcaccctggatgggccgtgggcctggttccggctgctggagcaatcggacctgacc
gccggcaactcgccggaccgcttcaacctgcggctgcgggtcgatggcgccagcgcctct
tatgagctgcgggccaacagcgccttcaacccattcaagagccgggtgctcagcggcttc
agcctgccggagcggctatga

DBGET integrated database retrieval system