KEGG   Pseudomonas fluorescens F113: PSF113_5826
Entry
PSF113_5826       CDS       T01734                                 

Gene name
tssE2
Definition
(GenBank) TssE2
  KO
K11905  type VI secretion system protein
Organism
pfe  Pseudomonas fluorescens F113
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfe02044]
    PSF113_5826 (tssE2)
Secretion system [BR:pfe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSF113_5826 (tssE2)
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AEV65800
UniProt: G8Q744
Position
complement(6722942..6723352)
AA seq 136 aa
MTYGSLFERLAGDSEKRAGLSREMCVVTSVAAHLAKMLSTRAGSVQTLSDYGLPDLNDMR
LSLHDAGSQARKAIEAFIKAYEPRLRNVCVVSIPSHADPLRLSFSIDALLDVEGVRRQVS
FSACLDGSGQVKVRQG
NT seq 411 nt   +upstreamnt  +downstreamnt
atgacgtatggcagccttttcgagcgcctggccggtgattcagaaaagcgcgcgggcttg
agccgtgagatgtgtgtcgtgacatcggtggctgcgcatctggccaagatgctcagcacc
cgggcaggtagcgtgcagacgctatccgattatgggctaccggatctcaatgacatgcgc
ttgagcctgcacgacgcagggagccaggcccgcaaggcgatcgaggcgttcatcaaggcc
tacgagccacgcctcaggaatgtctgtgtcgtttcaataccaagtcatgccgatccgctt
cgcctgtccttcagcatcgacgctttgctggatgtggagggggtcaggcgacaggtcagt
ttttccgcgtgcctggacggcagcggtcaggtcaaggtcagacaaggatag

DBGET integrated database retrieval system