KEGG   Pseudomonas fluorescens F113: PSF113_5828
Entry
PSF113_5828       CDS       T01734                                 

Gene name
impB3
Definition
(GenBank) ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pfe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSF113_5828 (impB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfe02044]
    PSF113_5828 (impB3)
Secretion system [BR:pfe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSF113_5828 (impB3)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEV65802
UniProt: G8Q746
Position
complement(6724862..6725365)
AA seq 167 aa
MAKEGSIAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTHRRDERKIEDRKPIGIDKM
TFDEVLAKQELNLILSVPNRLQEESETEELAVQLRVNSMKDFNPASLVEQVPELSKLMEL
RDALMALKGPLGNAPAFRKAIEGVLGNDDSRRRVLDELGLNTTAKNA
NT seq 504 nt   +upstreamnt  +downstreamnt
atggccaaagaaggctcgatcgcccccaaggaacgcatcaacgtcaccttcaaacctgcc
accggcggtgcccaggaagaaattgaactgccgttgaaactattggcgatcggtgattac
acccaccgcagggatgaacgcaagatcgaggaccgcaagccgattggcatcgacaagatg
accttcgacgaggtgttggccaagcaagagctgaacctgatcttgagcgtaccgaatcgt
ctccaggaagaaagcgaaactgaagagctggcagtacagctgcgtgtgaactcgatgaag
gatttcaacccggctagcctggtcgagcaagtgccggagctcagcaaactgatggagttg
cgcgacgccctgatggcgctcaaagggccattgggtaacgcgccggcgtttcgcaaggcc
atcgaaggcgtactcggcaatgacgattcccgccgccgcgtactggatgagctgggcctg
aacaccacagctaagaacgcttga

DBGET integrated database retrieval system