KEGG   Pseudomonas simiae PICF7: PFLUOLIPICF700365Help
Entry
PFLUOLIPICF700365 CDS       T03767                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pff  Pseudomonas simiae PICF7
Pathway
pff00361  Chlorocyclohexane and chlorobenzene degradation
pff00625  Chloroalkane and chloroalkene degradation
pff01100  Metabolic pathways
pff01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PFLUOLIPICF700365
   00361 Chlorocyclohexane and chlorobenzene degradation
    PFLUOLIPICF700365
Enzymes [BR:pff01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PFLUOLIPICF700365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like APH
Motif
Other DBs
NCBI-ProteinID: AJZ92141
Position
complement(83004..83627)
Genome map
AA seq 207 aa AA seqDB search
MTVRAVVFDFGGVLFDWSPQHLYRTLIADDGERQWFLENICTQAWNTEQDAGRSLAEGTR
SLIEQHPHHERLIQAYYDRWHEMLRGPLTEGVAILEALHQADMPLFGLTNWSAETFPYAR
ANYPFLQFFRDIVVSGELKLIKPDAAIYDASLSQVRAHLPDIQAAEVVFIDDVAGNIEAA
IALGWRGIHHVSAERTAAQLREWGVGF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcgtgcagtggtttttgatttcggcggggttctgttcgattggagcccgcag
cacctttaccgcacgctgattgccgatgatggcgaacggcagtggtttctcgagaatatc
tgtacccaggcgtggaacaccgagcaggatgccggtcgctccctggccgaaggcacccgc
agcctgatcgagcaacacccgcatcatgaacgcctgatccaagcctattacgatcgctgg
cacgaaatgctgcgtggcccgttgacggaaggcgtggcgatcctcgaggcgctgcaccag
gccgatatgccgctgttcgggctcaccaactggtcggctgagaccttcccgtatgcgcgg
gccaactaccccttcctccaattttttcgcgatatcgtggtgtccggcgagttgaaactg
atcaagcctgacgcagcgatctacgacgccagcctcagccaggtacgggcccacctgcca
gatatccaggcggcggaagtggtgtttatcgatgatgttgccggcaacatcgaagcagcc
atcgccctcggttggcgggggattcatcatgtgtccgccgagcgcactgccgctcaattg
cgagaatggggcgtgggcttttag

DBGET integrated database retrieval system