KEGG   Pseudomonas simiae PICF7: PFLUOLIPICF703445Help
Entry
PFLUOLIPICF703445 CDS       T03767                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
pff  Pseudomonas simiae PICF7
Pathway
pff00051  Fructose and mannose metabolism
pff00520  Amino sugar and nucleotide sugar metabolism
pff01100  Metabolic pathways
pff01110  Biosynthesis of secondary metabolites
pff01130  Biosynthesis of antibiotics
pff02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PFLUOLIPICF703445
   00520 Amino sugar and nucleotide sugar metabolism
    PFLUOLIPICF703445
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PFLUOLIPICF703445
Enzymes [BR:pff01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     PFLUOLIPICF703445
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     PFLUOLIPICF703445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AJZ92673
Position
750470..751921
Genome map
AA seq 483 aa AA seqDB search
MIPVILSGGSGSRLWPLSRKQFPKQFLALTGEHTLFQQTLERLVFEGMDSPIVVCNKDHR
FIVNEQLAARKLESQRILMEPFGRNTAPAVALTAMMLVNEGRDELMLVLPADHVIDDQKA
LQRALALATVAAERGEMVLFGVPATRPETGYGYIKSTNDSLLPEGVSRVEQFVEKPNEKR
AMEFVKSGGYFWNSGMFLFRASRFLEELKKHDPDIYDTCLLTLERSEQTADTVSFDEATF
ACCPDNSIDYAVMEKTQRACVVPLSAGWSDVGCWASLWAVNDKDVHGNVSKGDVVIQDSR
NCMIHGNGKLVSVIGLDNIVVVETKDAMMIAHKDKVQGVKQMVSTLNDQGRSETQNHCEV
YRPWGSYDSVDMGGRFQVKHISVKPGACLSLQMHHHRAEHWIVVSGTAEVTCDENVFLLT
ENQSTYIPIASVHRLRNPGKIPLEIIEVQSGSYLGEDDIERFEDIYGRSTPVERGVSVKT
IAQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgattccagtcatcctttccggtggtagcggctcacgtctttggccgctttcgcgtaaa
cagttccctaaacaattcctggccctgaccggcgagcacacgctgttccagcaaaccctg
gagcgcctggtgtttgaaggcatggactccccaatcgtggtctgcaacaaggaccaccgc
tttatcgtcaacgagcaactggccgcgcgtaagctcgaaagccagcgcatcctgatggaa
ccgttcggccgcaacaccgcgccggccgtggccctcaccgcgatgatgctggtcaatgaa
ggccgcgacgagctgatgctggtgttgcccgccgaccacgtgatcgacgaccagaaagcc
ctgcagcgtgcgctggccctggccaccgtggccgccgagcgtggcgagatggtgctgttc
ggcgtgccggccacccgtccggaaaccggttatggctacatcaagtccaccaacgattcg
ctgctgcccgaaggcgtgagccgcgtcgagcagttcgtggaaaaacccaatgaaaaacgc
gccatggagttcgtcaagagcggcggttacttctggaacagcggtatgttcctgttccgc
gccagccgcttcctcgaagagctgaaaaagcacgacccggacatctacgacacctgcctg
ctgacccttgaacgcagcgaacagaccgccgacacggtgtccttcgacgaagccaccttc
gcctgctgcccggacaactccatcgactacgccgtgatggaaaaaacccagcgcgcctgc
gtggtgccgctgagcgccggttggagcgacgtgggttgctgggcctcgctgtgggccgtc
aacgacaaagacgtccacggcaacgtcagcaaaggcgacgtggtgatccaggacagccgc
aactgcatgatccacggcaacggtaaactggtgtcggtgatcggcctggacaacatcgtg
gtggtggaaaccaaggacgcgatgatgattgcccacaaggacaaggtccagggcgtcaaa
cagatggtctcgaccctcaacgaccagggccgcagcgaaacccagaaccactgcgaagtc
tatcgcccgtggggctcctacgactcggtggacatgggtgggcgtttccaggtcaagcac
atctcggtcaagccgggcgcgtgcctgtcgctgcagatgcaccaccaccgcgccgaacac
tggatcgtggtcagcggcaccgctgaagtcacctgtgacgagaacgtgttcctgctcacc
gagaaccagtccacctacattccgatcgcctcggtgcaccgcctgcgcaacccgggcaag
atcccgttggagatcatcgaagtgcaatcgggcagctatttgggcgaagacgacatcgag
cgctttgaagatatctacggtcgctcgacgccggttgaacgtggcgtgtcggtgaaaact
atcgcgcagtaa

DBGET integrated database retrieval system