KEGG   Pseudomonas simiae PICF7: PFLUOLIPICF704620Help
Entry
PFLUOLIPICF704620 CDS       T03767                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
pff  Pseudomonas simiae PICF7
Pathway
pff00471  D-Glutamine and D-glutamate metabolism
pff01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PFLUOLIPICF704620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pff01011]
    PFLUOLIPICF704620
Enzymes [BR:pff01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     PFLUOLIPICF704620
Peptidoglycan biosynthesis and degradation proteins [BR:pff01011]
 Precursor biosynthesis
  Racemase
   PFLUOLIPICF704620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AJZ92892
Position
complement(988982..989776)
Genome map
AA seq 264 aa AA seqDB search
MVKGAPIGVFDSGVGGLSVLDEIQQLLPHESLLYVADCGHIPYGEKTPAFIRERSRLVAE
FFREKGAKTFVIACNTATVAAVADLRQDYPDWPLVGMEPAVKPAAAATRSGVVGVLATTG
TLQSAKFAALLDRFATDVRVITQPCPGLVELIETGDLNSPALRKMLQGYIEPLLSAGCDT
IILGCTHYPFLKPLLAQMLPPSIILIDTGAAVARQLKRLLGERDLLADGKPEPAQFWTSG
DVYQLRNILPTLWKYPGVVRSFGA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggttaagggcgcgcctattggtgtgttcgactccggtgtcggcggtttgtcggtattg
gacgaaatccagcaattgttgccccatgagtcgttgctgtacgtggccgactgcgggcat
atcccctatggagagaaaacgcccgcgttcattcgcgagcgatcgcggttggttgccgag
tttttccgcgaaaagggcgccaagacctttgtgatcgcttgcaataccgcgacggtcgcg
gcggttgctgacttgcgccaggattatcccgactggccactggtgggcatggagccggcc
gtcaaaccggccgccgcagcgacccgtagtggcgtggtcggcgtgcttgccaccaccggt
accctgcaaagcgccaaattcgcggcattactcgaccgtttcgcgacggatgtgcgggtc
attacccaaccctgcccagggctggtggaactgattgaaaccggcgacctgaacagcccc
gccctgcgcaagatgttgcagggatacatagagccgctgctcagcgccggctgtgacacc
atcatccttggctgcacccactaccccttcctcaagccactcctggcgcagatgttgccc
cccagcatcatcctcatcgacaccggcgccgctgtggcccgccagctcaagcgtttgctg
ggcgagcgcgacctgttggccgacggcaagcctgaacctgcacagttctggaccagcggc
gatgtgtatcagctaagaaatatcctaccgacactatggaaatatccgggcgttgtgcga
agctttggtgcgtga

DBGET integrated database retrieval system