KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF708585Help
Entry
PFLUOLIPICF708585 CDS       T03767                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
pff  Pseudomonas fluorescens PICF7
Pathway
pff00020  Citrate cycle (TCA cycle)
pff00620  Pyruvate metabolism
pff01100  Metabolic pathways
pff01120  Microbial metabolism in diverse environments
pff01200  Carbon metabolism
pff01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFLUOLIPICF708585
   00620 Pyruvate metabolism
    PFLUOLIPICF708585
Enzymes [BR:pff01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     PFLUOLIPICF708585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 RnfC_N HlyD_D23 NQRA GCV_H 53-BP1_Tudor
Motif
Other DBs
NCBI-ProteinID: AJZ93591
Position
1884877..1886685
Genome map
AA seq 602 aa AA seqDB search
MSKKIFVTDTILRDAHQSLLATRMRTDDMLPICDKLDKVGYWSLEVWGGATFDACVRFLK
EDPWERLRKLRAALPNTRLQMLLRGQNLLGYRHYSDDVVKAFVAKAAVNGIDVFRIFDAM
NDVRNLRVAIEAVKAAGKHAQGTIAYTTSPVHTVEAFVAQAKQLESMGCDSIAIKDMAGL
LTPYATGELVKALKAEQSLPIFIHSHDTAGLAAMCQLKAIENGADHIDTAISSFAWGTSH
PGTESMVAALKGSEFDTGLSLELLQEIGLYFYAVRKKYHQFESEFTAVDTRVQVNQVPGG
MISNLANQLKEQGALNRMNEVLAEIPRVREDLGFPPLVTPTSQIVGTQAFFNVLAGERYK
TITNEVKLYLQGGYGKAPGIVNEKLRRQAIGSEEVIDVRPADLLKPEMTKLRGEIGALAK
SEEDVLTYAMFPDIGRKFLEERDAGTLAPEVLLPIPEAGGVARVGGEGVPTEFVIDVHGE
SYRVDITGVGVKAEGKRHFYLSIDGMPEEVVFEPLNEFVSGGSSNRKHATAPGHVSTAMP
GNIVDVLVKEGDVVKAGQAVLITEAMKMETEVQAAIAGKVTAVHVAKGDRVNPGEILIEI
EG
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaaatcttcgtaaccgacaccatcctgcgcgacgcccaccaatcgttgctg
gcgacccgcatgcgtaccgacgacatgctgccgatctgcgacaagctcgacaaagtcggc
tactggtccctggaagtctggggcggcgcgaccttcgacgcctgtgtgcgcttcctcaag
gaagacccgtgggagcgcctgcgcaaactgcgcgccgcgttgcccaacactcgcctgcag
atgctgctgcgcggccagaacctgctgggctaccgccactacagcgacgacgtggtcaaa
gccttcgtcgccaaggctgccgtaaatggcatcgacgtattccgcattttcgacgccatg
aacgacgtgcgtaacctgcgcgtggcgatcgaagcggtgaaagccgccggcaaacacgcc
caaggcaccatcgcctacaccaccagcccggtgcacaccgtcgaagcttttgtggcccag
gccaagcagctggaatccatgggttgcgactcgattgcgatcaaggacatggccggcctg
ctgacgccgtacgccaccggcgaactggtcaaggcgttgaaggccgagcaaagcctgccg
atcttcatccactcccacgacaccgccggcctggctgcgatgtgccagctcaaggccatc
gaaaacggtgccgaccacatcgataccgccatctccagcttcgcctggggcaccagccac
ccaggcaccgagtcgatggtcgccgcccttaaaggcagcgaattcgacactggcctgagc
ctggaactgctgcaggaaatcggcctgtatttctacgccgtgcgtaagaaataccaccag
ttcgaaagcgaattcaccgcggtcgatacccgcgttcaagtcaaccaggtgcccggcggg
atgatttccaacctggccaaccagttgaaagagcagggtgcgctcaaccgcatgaacgaa
gtgctggcggaaatcccgcgtgtgcgtgaagacctcggcttcccgccgctggtcactccg
acctcgcagatcgtcggcacccaggcgttcttcaacgtgttggctggcgagcgctacaaa
accatcaccaacgaagtgaagctctacctgcaaggcggctacggcaaggcgccaggcatt
gtgaacgagaaactgcgtcgccaggccatcggcagcgaagaggtgatcgacgtacgcccg
gccgacctgctcaagccggaaatgaccaagctgcgcggcgagatcggcgcgttggccaag
tctgaagaagacgtgctgacctatgccatgttcccggacatcgggcgcaagttcctcgaa
gaacgcgacgccggcaccctggcgcctgaagtgctgttgccgatccctgaagccggcggc
gtggcgcgcgtcggtggcgagggcgtaccgactgaatttgtgatcgacgtgcacggtgaa
agttaccgcgtggacatcaccggtgtgggcgtgaaggctgaaggcaagcgccatttctac
ctttccatcgatggcatgccggaagaagtggtgttcgaaccgctcaacgagtttgtcagc
ggtggcagcagcaaccgcaagcacgctacggcgccgggtcatgtcagcaccgcaatgccg
ggcaatatcgtcgacgtgctggtcaaggaaggcgacgtggtcaaggccggccaggccgtg
ctgattaccgaagccatgaagatggaaaccgaagtgcaggccgctattgccggcaaggtg
accgcggttcatgtggccaagggcgaccgggtcaaccctggcgaaatcctgattgaaatc
gaaggctga

DBGET integrated database retrieval system