KEGG   Pseudomonas simiae PICF7: PFLUOLIPICF726225Help
Entry
PFLUOLIPICF726225 CDS       T03767                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pff  Pseudomonas simiae PICF7
Pathway
pff00010  Glycolysis / Gluconeogenesis
pff00053  Ascorbate and aldarate metabolism
pff00071  Fatty acid degradation
pff00280  Valine, leucine and isoleucine degradation
pff00310  Lysine degradation
pff00330  Arginine and proline metabolism
pff00340  Histidine metabolism
pff00380  Tryptophan metabolism
pff00410  beta-Alanine metabolism
pff00561  Glycerolipid metabolism
pff00620  Pyruvate metabolism
pff00625  Chloroalkane and chloroalkene degradation
pff00903  Limonene and pinene degradation
pff01100  Metabolic pathways
pff01110  Biosynthesis of secondary metabolites
pff01120  Microbial metabolism in diverse environments
pff01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFLUOLIPICF726225
   00053 Ascorbate and aldarate metabolism
    PFLUOLIPICF726225
   00620 Pyruvate metabolism
    PFLUOLIPICF726225
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PFLUOLIPICF726225
   00561 Glycerolipid metabolism
    PFLUOLIPICF726225
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFLUOLIPICF726225
   00310 Lysine degradation
    PFLUOLIPICF726225
   00330 Arginine and proline metabolism
    PFLUOLIPICF726225
   00340 Histidine metabolism
    PFLUOLIPICF726225
   00380 Tryptophan metabolism
    PFLUOLIPICF726225
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFLUOLIPICF726225
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PFLUOLIPICF726225
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PFLUOLIPICF726225
Enzymes [BR:pff01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PFLUOLIPICF726225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJZ96489
Position
complement(5668238..5669659)
Genome map
AA seq 473 aa AA seqDB search
MNHLDFYIDGQWVKPLGGDTLPVVDPTTERTVATISLGTLADLDRAVTAARRAFDSYGQW
TREQRLELLAAIIDGYRQHSEALAQCVHQEMGAPLSLARSAHVPAGLGHLQRAYDVLKAY
AFEYAHDSTLISREPIGVCGLITPWNWPLNQLTCKLAPALAAGCTMVLKPSEKAPLSAML
LADILDHAGVPKGVFNLVNGDGPTMGDGIARHAGIDMVSFTGSTGAGIAVAKAAADTVKR
VSQELGGKSANLILADADLDAAVRHGVSSCFRNSGQSCNAPTRLLVPRALQARAVAIAQE
IAAQVCFDDSNPATAMGPLANQAQFERVQALLAAVDIPPVCGGAGRPQGINRGFYVRPTV
FADVHPDLPIAREEVFGPVLVIIPYDSEEQAIAIANDSPYGLSGYVTAGTLEGARRVARR
LRTGMVHLNGSKADNGAPFGGYKQSGNGREWGVFGLEDYLEVKSLFGYQPNLG
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacctggatttctacatcgacgggcagtgggtcaagcccctcggcggcgacacc
ttgccggtggtcgacccgacgacggagcgaaccgtcgccaccatcagcctcggcaccctg
gccgacctcgaccgcgccgtcaccgcggccaggcgggccttcgacagctatgggcaatgg
acgcgcgagcaacgcctggaactgctggcggcgatcatcgatggctatcgccagcacagc
gaagccctggcgcaatgcgtgcaccaggaaatgggcgcgccgctctcgctggcgcgcagt
gcccatgtgcccgcggggttgggccacttgcagcgtgcgtatgacgtgctcaaggcatat
gccttcgaatatgcccacgacagcaccctgatcagccgcgaaccgataggggtgtgcggc
ctgatcacaccgtggaactggccactcaaccaactcacctgcaagctcgcgccggccctg
gccgcgggctgcacgatggtgctcaagcccagtgaaaaggcgccgctgtcggcgatgctg
ctggccgatatcctggaccatgccggggtgcccaagggcgtgttcaacctggtcaatggc
gacggtcctacgatgggcgacggcatcgcccggcatgccgggatcgatatggtctcgttt
accggttccaccggcgcgggcatcgctgtggccaaggcggcagcggacacggtcaagcgt
gtctctcaggagctgggcggcaagtcggccaacctgattcttgccgatgcggacctggac
gctgccgtgcgacacggtgtgagcagctgttttcgcaacagcggccagtcctgcaatgcg
ccgacgcgcctgctggtgccccgggccttgcaagcgcgggcggtggcgatcgcccaggag
attgccgcgcaggtctgctttgacgatagcaatccagcgactgccatgggccccctggcc
aaccaggcgcagttcgaacgggtgcaggcgctgttggcggccgtggacatcccaccggta
tgcggtggtgcagggcggccgcaaggcatcaaccgcggcttctacgtgaggcccacggtc
tttgccgatgtccaccccgacctgccgattgcccgcgaagaggtgttcgggccggtgttg
gtgatcattccctacgacagcgaagaacaggcgattgccatcgccaatgacagcccctat
ggcctgtcgggttacgtcacggccggcacgctggaaggcgcgcgcagggtcgcccgccgt
ctgcgcacggggatggtccatctcaatggcagcaaggcggataacggcgcgccctttggc
gggtacaagcagtccggtaatggccgtgagtggggggtatttggcctggaggactatctg
gaagtgaaatcgctgtttggctatcagcctaacctgggataa

DBGET integrated database retrieval system