KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF726835Help
Entry
PFLUOLIPICF726835 CDS       T03767                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
pff  Pseudomonas fluorescens PICF7
Pathway
pff00072  Synthesis and degradation of ketone bodies
pff00280  Valine, leucine and isoleucine degradation
pff00650  Butanoate metabolism
pff01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PFLUOLIPICF726835
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PFLUOLIPICF726835
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFLUOLIPICF726835
Enzymes [BR:pff01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     PFLUOLIPICF726835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AJZ96585
Position
5806721..5807380
Genome map
AA seq 219 aa AA seqDB search
MALTREQMAQRVAREMQDGFYVNLGIGIPTLVANYIPEGMEVMLQSENGLLGMGPFPTEE
TIDADMINAGKQTVTARIGASIFSSAESFAMIRGGHVDLTVLGAFEVDVQGNIASWMIPG
KLVKGMGGAMDLVAGAENIIVIMTHASKDGESKLLSQCSLPLTGAHCIKRVLTDLAYLEI
ENGAFVLKERAPGVSVEEIVSKTAGKLIVPDHVPEMHFQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctcttacccgcgaacaaatggctcaacgcgtcgcccgcgaaatgcaggacggcttc
tacgtcaacctcggtatcggcattccgaccctggtggccaactacatccccgaaggcatg
gaagtgatgctgcaatcggaaaacggcctgctcggcatgggtccttttcctaccgaagaa
accattgatgccgacatgatcaacgccggcaagcagaccgtgaccgcacgcatcggtgcg
tcgatcttctcctccgccgagtccttcgcgatgatccgcggcggccacgtcgacctcact
gtacttggcgcgtttgaagtggacgtacaaggcaacatcgcgtcgtggatgatccccggc
aaactggtcaaaggcatggggggcgccatggacctggtggccggtgcagaaaacatcatc
gtgatcatgacccacgcgtccaaggacggtgagtcaaagttgctcagccagtgcagcctg
ccgctgaccggcgcccactgcatcaagcgtgtattgaccgacctggcctacctggaaatc
gaaaatggcgcttttgtcctcaaggaacgcgcacctggcgtcagcgttgaagagattgtg
agcaagaccgccggtaaactgatcgtcccggaccacgttccagaaatgcacttccagtga

DBGET integrated database retrieval system