KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF726840Help
Entry
PFLUOLIPICF726840 CDS       T03767                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pff  Pseudomonas fluorescens PICF7
Pathway
pff00071  Fatty acid degradation
pff00072  Synthesis and degradation of ketone bodies
pff00280  Valine, leucine and isoleucine degradation
pff00310  Lysine degradation
pff00362  Benzoate degradation
pff00380  Tryptophan metabolism
pff00620  Pyruvate metabolism
pff00630  Glyoxylate and dicarboxylate metabolism
pff00640  Propanoate metabolism
pff00650  Butanoate metabolism
pff00900  Terpenoid backbone biosynthesis
pff01100  Metabolic pathways
pff01110  Biosynthesis of secondary metabolites
pff01120  Microbial metabolism in diverse environments
pff01130  Biosynthesis of antibiotics
pff01200  Carbon metabolism
pff01212  Fatty acid metabolism
pff02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFLUOLIPICF726840
   00630 Glyoxylate and dicarboxylate metabolism
    PFLUOLIPICF726840
   00640 Propanoate metabolism
    PFLUOLIPICF726840
   00650 Butanoate metabolism
    PFLUOLIPICF726840
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PFLUOLIPICF726840
   00072 Synthesis and degradation of ketone bodies
    PFLUOLIPICF726840
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFLUOLIPICF726840
   00310 Lysine degradation
    PFLUOLIPICF726840
   00380 Tryptophan metabolism
    PFLUOLIPICF726840
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFLUOLIPICF726840
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFLUOLIPICF726840
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PFLUOLIPICF726840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pff04147]
    PFLUOLIPICF726840
Enzymes [BR:pff01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PFLUOLIPICF726840
Exosome [BR:pff04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFLUOLIPICF726840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJZ96586
Position
5807392..5808573
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLASIPAPELGAAVIRRLLEQTGLDPAQVDEVILGQVLTAG
SGQNPARQASILAGLPHAVPSLTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSL
APYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA
ASQQKATAAIEAGRFVDEITPILIPQRKGDPVAFAVDEQPRAGTTAESLAKLKPAFKKDG
SVTAGNASSLNDGAAAVLLMSADKAKALGLPVLARIASYANAGVDPAIMGIGPVSATRRC
LDKAGWSLGDLDLIEANEAFAAQSLAVGKELEWDAEKVNVNGGAIAIGHPIGASGCRVLV
TLLHEMIKRDAKKGLATLCIGGGQGVALALERS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtgattgttgctgccacccgcaccgccgtgggcagcttccagggttcg
ctggcaagcattccggctccggaactgggcgccgccgtgatccgtcgcctgttggaacag
accggccttgacccggcccaagtggatgaagtgatcctcggccaggtactcaccgccggc
agcggccagaacccggcacgccaggcctcgatcctcgccggcctgccccacgcggtgccg
agcctgaccttgaacaaggtctgcggctccggcctcaaggccctgcacctgggtgcccag
gccatccgttgcggtgacgccgaagtgatcatcgccggcggtatggaaaacatgagcctg
gccccttatgtactgccagccgcccgcaccggtttgcgcatgggccacgccaaaatgatc
gacagcatgatcaccgatggcctgtgggatgcgttcaacgactaccacatgggcatcacc
gccgaaaacctggtggacaagtacggcatcagccgcgaagcccaggacgctttcgctgcg
gcgtcccagcaaaaagccactgctgctatcgaagcggggcgctttgtcgatgagatcacc
ccgatcctgattccccagcgcaaaggcgacccggtggccttcgccgtggatgagcagccg
cgcgccggcaccactgccgagtccctggccaaactgaaacctgcgttcaagaaagacggc
agcgtcaccgccggcaacgcctccagcctcaacgacggcgccgctgcagtgctgctgatg
agcgccgacaaggccaaggccctcggcttgccggtactggcgcgcatcgccagctacgcc
aatgcgggcgtagaccctgccatcatgggcattggcccggtatcggccacccgccgctgc
ctcgacaaagccggctggagcctgggcgacctggacctgatcgaagccaacgaagccttc
gccgcgcaatccctggcggtgggcaaagagctggagtgggatgcagagaaggtcaacgtc
aacggtggtgccatcgccatcggccacccgatcggcgcgtctggctgccgtgtgctggtg
acgctgttgcacgaaatgatcaagcgcgatgccaagaaaggcctggcaacgctgtgcatc
ggtggcggccagggtgtggccctcgctctcgaacgcagctga

DBGET integrated database retrieval system