KEGG   Pandoraea faecigallinarum: AB870_03015Help
Entry
AB870_03015       CDS       T03972                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pfg  Pandoraea faecigallinarum
Pathway
pfg00260  Glycine, serine and threonine metabolism
pfg01100  Metabolic pathways
pfg01110  Biosynthesis of secondary metabolites
pfg01120  Microbial metabolism in diverse environments
pfg01130  Biosynthesis of antibiotics
pfg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB870_03015
Enzymes [BR:pfg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AB870_03015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AKM29325
UniProt: A0A0H3WPB2
Position
complement(3332918..3333919)
Genome map
AA seq 333 aa AA seqDB search
MRYLVEANASGHEVSYGDDTWTQRVCDGIRQLFDTDCEVFFVFNGTAANSLALASLSQSY
HSVICHELAHVETDECGGPEFFSNGAKLLTARGRDNNGKLTPEAVEAVINRRSDIHFPKP
KVVTLTQATEVGTVYTVDEIKAISAVAKRRNLRVHMDGARFANAVATLGCHPGDVTWRAG
VDVLCFGGTKNGLPVGEAVVFFNRALAEDFAYRVKQAGQLASKMRFISAPWLGMLENDTW
LRHARHANDMAQLLAARIRDVPGVSIMFETQANGVFAELPAFVIEALRARGWRFYTFIGA
GGCRFMCAWDTRVETVERLAADIRELSAQAAVA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacctcgtcgaggcgaatgccagcggtcacgaagtgtcgtacggcgacgatacg
tggacccaacgggtgtgcgacggcatccgccagttgttcgacaccgattgcgaagtcttc
ttcgtcttcaacggcactgcggcgaattccctcgcgctcgcgtcgctgtcgcagtcgtat
cactccgtcatctgccacgaactggcgcacgttgagacggacgaatgcggcgggccggag
tttttctccaacggcgcgaagctgctgaccgcgcgcggccgggacaataacggcaagctc
acgccggaggcggtcgaagccgtcatcaaccgtcgctccgacattcacttcccgaagccc
aaggtcgtgacgctcacgcaggcgaccgaagtcggtacggtctataccgtcgacgaaatc
aaggcgatctccgccgtggcaaagcgccgcaatttgcgcgttcacatggacggcgcacgc
tttgccaacgccgtggcgacgttggggtgccatccgggcgacgtcacctggcgtgctggc
gtggacgtgctgtgtttcggaggcacgaagaacggtctgccggtcggtgaggcggtggtg
ttctttaaccgtgcgctggcggaagacttcgcttaccgcgtgaagcaggcgggccaactg
gcgtcgaagatgcgtttcatttcggcaccgtggctgggcatgctggagaacgatacgtgg
ttgcgccatgcgcgccatgccaacgacatggcgcaactgctcgccgcgcgcattcgcgac
gtgccgggcgtgtcgatcatgttcgagacacaggccaacggcgtgttcgccgaactgccg
gcgttcgtgatcgaagcgttacgcgccaggggctggcgcttttacaccttcatcggtgcc
gggggctgccgcttcatgtgcgcatgggacacccgtgtggagacggtggagcgcctggct
gccgatatccgcgaactgagcgcgcaggcggccgtggcctga

DBGET integrated database retrieval system