KEGG   Pandoraea faecigallinarum: AB870_05700Help
Entry
AB870_05700       CDS       T03972                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfg  Pandoraea faecigallinarum
Pathway
pfg00071  Fatty acid degradation
pfg00072  Synthesis and degradation of ketone bodies
pfg00280  Valine, leucine and isoleucine degradation
pfg00310  Lysine degradation
pfg00362  Benzoate degradation
pfg00380  Tryptophan metabolism
pfg00620  Pyruvate metabolism
pfg00630  Glyoxylate and dicarboxylate metabolism
pfg00640  Propanoate metabolism
pfg00650  Butanoate metabolism
pfg00900  Terpenoid backbone biosynthesis
pfg01100  Metabolic pathways
pfg01110  Biosynthesis of secondary metabolites
pfg01120  Microbial metabolism in diverse environments
pfg01130  Biosynthesis of antibiotics
pfg01200  Carbon metabolism
pfg01212  Fatty acid metabolism
pfg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB870_05700
   00630 Glyoxylate and dicarboxylate metabolism
    AB870_05700
   00640 Propanoate metabolism
    AB870_05700
   00650 Butanoate metabolism
    AB870_05700
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB870_05700
   00072 Synthesis and degradation of ketone bodies
    AB870_05700
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB870_05700
   00310 Lysine degradation
    AB870_05700
   00380 Tryptophan metabolism
    AB870_05700
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AB870_05700
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB870_05700
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AB870_05700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfg04147]
    AB870_05700
Enzymes [BR:pfg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AB870_05700
Exosome [BR:pfg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AB870_05700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKM29717
UniProt: A0A0H3WPF4
Position
complement(3936515..3937681)
Genome map
AA seq 388 aa AA seqDB search
MVAACLTGWAHSQFGKLDNVDAEVLLADVAQAALDDAGLSPEQIDSIHVGTFNGGFLYQD
FPSSLVFNRISGLRFKPATRYENACATGSAAVHGGLQSIEAGKATHVLVIGFEKMTELAT
PQVGEVLLKCSYAREEAGIPGGFAGVFGTIAQAYFERYGDQSDALARIAAKNHRNGSVNP
YAHMRRDFGYDFCRNVSEKNPFVAGPLKRTDCSMVSDGAAALVISKADVARTMPKSVGFR
AAVQVNDYLPLSRRDPLAFEGGQHAWRQALGVAGVSLRDLSLVETHDCFTIAELIEYEAM
GLAKPGQGANVLAEGLTEKNGLLPVNPSGGLKAKGHPVGATGVSMHVMAAMQLTGTAGEM
QIPNAKLAGVFNMGGAAVANYVSILEAR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggttgctgcatgccttaccggctgggcccactcccagttcggcaaactcgataacgtc
gacgccgaagtcctgctggccgacgtcgctcaggccgcactcgacgatgcgggcctttcg
cccgaacagatcgattcgattcacgttggcactttcaatggcggtttcctgtatcaggac
ttcccgtcctcgctcgtcttcaaccgcatttccgggctgcgcttcaagccggccacgcgt
tacgagaatgcgtgcgccacgggatcggctgccgtgcatggcggactgcaatcgatcgaa
gcgggcaaagccacgcatgtgctcgtgatcggcttcgagaaaatgacggagctcgccacg
ccgcaggtcggcgaggtgttgctcaagtgttcgtatgcacgtgaggaagccggaatcccc
ggggggttcgcgggcgtattcgggaccatcgcgcaggcgtatttcgagcgttacggcgat
cagtccgatgccctcgcgcgtatcgccgccaagaaccatcgcaatggcagtgtgaatccg
tacgcgcacatgcgccgcgatttcggctacgacttttgccgcaacgtctccgagaagaac
ccgttcgtggctggtccgctcaagcgcacggactgctcgatggtctccgacggggcggca
gcgctcgtgatctcgaaggcggacgtcgcgcgcaccatgcccaagtcggtcggctttcgc
gcggcggtgcaggtcaacgattacctgccgctctcgcggcgcgatccgctcgcgttcgag
ggcggtcagcacgcgtggcgccaggcgctgggcgttgccggggtttcgctcagggatctg
tcgctggtcgagacgcacgattgcttcaccatcgccgaactgatcgagtacgaggcgatg
ggcctggcgaagccggggcagggcgcgaatgtcctggctgaagggctgacggaaaagaac
gggctgctgccggtcaatccgtcgggtggcctgaaggcgaaggggcatccggtcggcgcg
accggtgtgtcgatgcacgtgatggcggcgatgcaattgacgggcacggccggggagatg
cagatcccgaacgccaagctcgcgggcgtcttcaacatgggcggcgcggcggtggcgaac
tacgtgagcattctcgaagcacgctga

DBGET integrated database retrieval system