KEGG   Plasmodium falciparum HB3: PFHG_00465Help
Entry
PFHG_00465        CDS       T01052                                 

Definition
(Broad) plasmepsin 2 precursor
  KO
K06008  plasmepsin II [EC:3.4.23.39]
Organism
pfh  Plasmodium falciparum HB3
Brite
KEGG Orthology (KO) [BR:pfh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pfh01002]
    PFHG_00465
Enzymes [BR:pfh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.39  plasmepsin II
     PFHG_00465
Peptidases and inhibitors [BR:pfh01002]
 Aspartic peptidases
  Family A1: pepsin family
   PFHG_00465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N Asp_protease_2 DUF4271
Motif
Structure
PDB: 

AA seq 453 aa AA seqDB search
MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE
NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT
NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH
LYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT
ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEER
FYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDV
IKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPV
PTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggatattacagtaagagaacatgattttaaacatggctttatcaaaagcaattcaaca
tttgatggattaaacattgacaattcaaagaacaaaaaaaaaatacagaaaggatttcaa
atactatatgtacttctcttttgtagtgtaatgtgtggtttattttattatgtgtatgaa
aatgtatggcttcaaagagataatgaaatgaatgaaattttaaaaaattccgaacattta
actattggatttaaagttgaaaatgcacatgatagaattttgaaaactataaaaacacat
aaattaaaaaattacattaaagaatctgtcaattttcttaattcaggacttactaaaaca
aattatttaggtagttcaaatgataatatcgaattagtagatttccaaaatataatgttt
tatggtgatgcagaagttggagataaccaacaaccatttacatttattcttgatacagga
tctgctaatttatgggtcccaagtgttaaatgtacaactgcaggatgtttaactaaacat
ctatatgattcatctaaatcaagaacatatgaaaaagatggaaccaaagtagaaatgaat
tatgtgtcaggaactgttagtggatttttcagtaaagatttagtaactgttggtaattta
tctcttccatataaatttattgaagtaatagatactaatggattcgaaccaacttatact
gcttcaacatttgatggtatccttggtttaggatggaaagatttatcaataggttcagta
gatccaattgttgttgaattaaaaaaccaaaacaaaattgaaaatgctcttttcaccttt
tacttacctgtacatgataaacatacaggattcttaaccattggtggtattgaagaaaga
ttttatgaaggaccactaacttacgaaaaattaaaccacgatttatattggcaaataact
ttagatgcacacgttggaaatataatgttagaaaaagcaaactgtattgtagatagtggt
actagtgccattactgtaccaactgactttttaaataaaatgttgcagaatttagatgtt
atcaaagtcccattcttacctttctatgtaactctttgtaacaacagcaaattaccaact
tttgaatttacctcagaaaatggtaaatacacattagaacctgaatactaccttcaacac
atagaagatgttggtccaggattatgtatgcttaatatcataggattagattttccagta
ccaacctttattctaggtgacccattcatgagaaaatattttaccgtctttgattatgat
aatcacagtgttggtattgctcttgctaaaaagaatttataa

DBGET integrated database retrieval system