KEGG   Plasmodium falciparum HB3: PFHG_01560Help
Entry
PFHG_01560        CDS       T01052                                 

Definition
(Broad) hypothetical protein similar to methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pfh  Plasmodium falciparum HB3
Pathway
pfh00450  Selenocompound metabolism
pfh00970  Aminoacyl-tRNA biosynthesis
pfh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PFHG_01560
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PFHG_01560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfh01007]
    PFHG_01560
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfh03016]
    PFHG_01560
Enzymes [BR:pfh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PFHG_01560
Amino acid related enzymes [BR:pfh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PFHG_01560
Transfer RNA biogenesis [BR:pfh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PFHG_01560
 Prokaryotic type
   Other AARSs
    PFHG_01560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
AA seq 747 aa AA seqDB search
MKIYFIFILFLYLNFFILIIEILSKDIIKTRRSFPSYIKDGEKRKSNKIKRKRIKNDAYI
NVYRKNILDSINIKGDQNKIKEKWLQNLKKKKAFDKISVRLSNYNDDKKEIFDITFVNNK
EDRNDDNYDNKSCIKKVCNAEEYLLISTPVYYSNDRPHIGHAYCNILCDVLYKYEKLKGV
EKKKKGIIFFSGMDEHGLKIEKKCNKNKMKIIEYIDDISNYYKDMNKKLSVDVNLFYRTS
YSFHKMFVQNVWKYLVHNNYIYKDTYKGYYNINEERYISEQELREGKYKIDNENIIYVEE
ENSYFFNILKFKDYLIDFYEKNENFIYPPYLRKQVIYTLKNELRNICISRYNTKWAIQIP
NEAEGTIYVWFDALLSYVSSMLYLHKIKKNNNNNNNNKNNNNNNNKNNNNKNNKNNNNGI
NCTNGTKDVNISSTCDTDSPICSYDDILNIVNLNANNNNTQSNILPHISSNICDEKKNEK
REKNIPFNKVIGKKFWNPFIQVIGKDILNFHAILYICLLKSLNLELPQKILCHGLIKNEN
IKMSKSLNNVVNPFDLLKKYNPDVLRLYFMGCGSIYEDKNYKEQNIESFELFLRNNVGNL
LYRVVSLCIENNYNMVPVIKTNDYDSNIILNEWKDNIKNKLIPYLDNMEYIQFLELIMTL
IKNVNKFFVHNTPWNYKKDTQHFHTTIYVTLECMKYFSILMFPFIPNISLAILRNIGFDD
IDEENISLDMLETRTTKFMLNGLIKIV
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttattttatttttatattatttttgtatctaaatttttttattttaattata
gaaatattaagcaaagatataataaaaactagacgctcttttccttcatatataaaggat
ggagagaaaagaaaaagcaataaaataaaaagaaaacgaataaaaaatgatgcttatata
aatgtttataggaaaaatatattggatagcataaatataaaaggtgatcaaaataaaatt
aaagaaaaatggttgcagaatttaaaaaagaaaaaagcatttgacaaaataagtgtgcgt
ttatcaaattataatgatgataaaaaagagatatttgatataacgtttgtaaataataaa
gaagacaggaatgatgataattatgataataagagttgtattaaaaaagtttgtaatgct
gaagaatatttacttattagtactcctgtatattattcaaatgatagaccacatataggt
catgcatattgtaatatattatgtgacgttctatataaatatgaaaaattaaaaggggta
gagaaaaagaaaaagggtataatttttttttcaggtatggatgagcacggtttaaaaatt
gaaaagaagtgtaataaaaataaaatgaaaataattgaatatattgatgatatatctaat
tattataaagatatgaataagaaattaagtgtggatgtaaatttattttataggacatct
tattcatttcataaaatgtttgttcagaatgtatggaaatatttagtacataataattat
atatataaagatacatataaaggttattataatattaatgaagaaagatatataagtgaa
caagaattaagagaaggtaaatataaaatagataatgaaaatattatatatgttgaagag
gaaaatagttatttttttaatatattaaaatttaaagattatttaattgatttctatgaa
aagaatgaaaattttatatatccaccatatttaagaaaacaggtaatttataccttaaaa
aatgaattaagaaatatatgtataagtaggtataatacaaagtgggcaatacaaatacct
aatgaagcagaaggtactatctacgtgtggtttgatgctttgttatcatatgtaagttct
atgttatatctacataaaataaaaaaaaataataataataataataataataaaaataat
aataataataataataaaaataataataataaaaataataaaaataataacaatggtata
aattgtacaaatggtacaaaagatgtgaatatatcctctacatgcgatacggattctccc
atttgctcatatgatgatattttaaatatcgtaaatttgaatgctaataataataataca
caaagtaatatacttccacatataagcagcaacatatgtgatgaaaaaaaaaatgaaaaa
agagaaaaaaatattccattcaacaaagtaatcggtaaaaaattctggaatccatttatc
caagttataggtaaagatattttgaatttccatgccatattgtatatatgtttgttgaaa
agtttaaatcttgagcttccacaaaaaattctatgtcatggtttaataaaaaatgaaaat
ataaaaatgtccaagagcttaaataatgttgtaaatccatttgaccttttaaaaaaatat
aatccagatgtattacgtttatattttatgggatgtggtagtatttatgaagataaaaat
tataaagaacaaaatatagagtcattcgaattatttttaagaaataacgtaggcaatcta
ttatatcgtgtagtatccttatgtatagaaaataattataatatggttcctgttataaaa
acaaatgattatgattctaatattattttaaatgagtggaaagataatataaagaataaa
ctcataccatatcttgataatatggaatatattcaatttttggaacttattatgacatta
ataaaaaatgtaaataaattttttgtacataatacaccatggaattataaaaaagataca
caacattttcacacaactatttatgttactttggagtgtatgaaatatttttctatatta
atgttcccatttataccaaacatttctttggctattttaagaaatattggtttcgatgac
attgacgaggagaatatatctctcgacatgttggaaacaaggacgacaaaatttatgctt
aatgggttgataaaaatagtgtga

DBGET integrated database retrieval system