KEGG   Plasmodium falciparum HB3: PFHG_04209Help
Entry
PFHG_04209        CDS       T01052                                 

Definition
(Broad) hypothetical protein similar to guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pfh  Plasmodium falciparum HB3
Pathway
pfh00230  Purine metabolism
pfh01100  Metabolic pathways
Module
pfh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PFHG_04209
Enzymes [BR:pfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PFHG_04209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_33 AAA_18 RsgA_GTPase AAA_14 AAA MMR_HSR1 ABC_tran AAA_17 RNA_helicase AAA_16 NTPase_1 TraI_2_C NB-ARC AAA_5 ATPase_2 Roc MobB NACHT
Motif
Structure
PDB: 

AA seq 199 aa AA seqDB search
MNNIYPLVICGPSGVGKGTLIKKLLNEFPNYFYFSVSCTTRKKREKEKEGVDYYFIDKTI
FEDKLKNEDFLEYDNYANNFYGTLKSEYDKAKEQNKICLFEMNINGVKQLKKSTHIKNAL
YIFIKPPSTDVLLSRLLTRNTENQEQIQKRMEQLNIELHEANLLNFNLSIINDDLTLTYQ
QLKNYLLNSYIHLNNHTRN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatttatcccctggttatttgtggtccttcgggtgttggtaaaggtaccttg
ataaaaaagctgttgaatgaatttccaaattatttttatttttccgtaagctgtacgaca
agaaaaaagagagagaaagaaaaagaaggtgtagattattatttcatagataagactata
tttgaagataaattaaaaaatgaagattttttagaatatgataattatgctaataatttt
tatggaacattaaaaagtgaatatgataaagcaaaagaacaaaataaaatctgcttattt
gaaatgaatattaatggtgtcaaacaattgaaaaaatcaacacatataaaaaatgctctc
tatatatttattaaaccaccaagtactgatgtactcttaagtagattattaacaagaaat
acagaaaatcaagaacaaatacaaaaacgtatggaacaattgaatatcgaattacatgaa
gcaaacttattaaattttaatttatcaattattaatgatgatttaacattaacatatcaa
cagctcaaaaattatttacttaattcatacattcacttgaataatcacacaaggaattaa

DBGET integrated database retrieval system