KEGG   Plasmodium falciparum HB3: PFHG_04976Help
Entry
PFHG_04976        CDS       T01052                                 

Definition
(Broad) conserved hypothetical protein
  KO
K12736  peptidylprolyl isomerase domain and WD repeat-containing protein 1 [EC:5.2.1.8]
Organism
pfh  Plasmodium falciparum HB3
Brite
KEGG Orthology (KO) [BR:pfh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pfh03041]
    PFHG_04976
   03110 Chaperones and folding catalysts [BR:pfh03110]
    PFHG_04976
Enzymes [BR:pfh01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     PFHG_04976
Spliceosome [BR:pfh03041]
 Complex C
  Other components
   PPlases
    PFHG_04976
Chaperones and folding catalysts [BR:pfh03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    PFHG_04976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase SR-25 FRG1
Motif
Structure
PDB: 

AA seq 748 aa AA seqDB search
MSKNDEYKNEKGEGEELPSSDGESSDGSFGPVPLQQNKDNINDENYNDENYNDENYNDKN
YNDNDYISGNEKDVVLLDSKKKKKNSVSLCSSSSSINIPENEELLNKKKRKVKGIIEENK
KNQEKMKKKKIRINNDIYLKNLPTNKNYQVSYMHTDIVTHVVVSNKKKYIITASLNGIIK
FWYKNIGCIEFVKHFKIHSDEIINIFISEDEEHLGSLSKDKTYKQFDITSFDMNIVIKLS
FIPRTGEFIYSSIFSTEVKVAISSSEKACIYIYKPLESDICIQTIDFGCCNIIEIIKYNK
FYDLCVFSDNEGLLDIVDVTNFKFPTSKEEKKSKTNNNMDHKLIDFMNKRYPIKKINFSF
KSETDLYELCKYKTYALCISLSLDGEYMAILSENYFLRIYKFESMKLYRVYDESTEMYLT
AQNDPLKKELHIDSFDFGKRLFIEKEIKKYMKNQNINFNMISFDESNQYIIYSTFIGIKV
VNFITNQLCYIIGKNEANLRYLSISIYQNIIPINKVRTNIHESLYINEKNISDCALFCTV
YKKARFYVFSKKKLNEHELDDRDIYNEQPTKNDVNSLISNPLKNIETIHKNTPKSAIIYT
TMGDIHISLFYKECKKTVQNFSVHSINGYYNNCIFHRVIKHFMVQTGDPSGDGTGGESIW
GNEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKI
VLDIEKVRTDKRDKPLEDIKILNIKINN
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatgatgaatataaaaatgaaaaaggagaaggagaagaattaccttcttca
gatggtgagtcaagcgatggaagttttggtccagttccattacaacaaaataaggacaac
ataaatgatgagaattataatgatgagaattataatgatgagaattataatgataagaat
tataatgataatgattatattagtggtaatgagaaggatgtagttttgttggatagtaaa
aaaaaaaaaaaaaattctgtatcattatgctcatcttcatcatccataaatataccagaa
aatgaagaattattaaataaaaagaaaagaaaagtaaaaggaataatagaagagaacaaa
aaaaatcaagaaaagatgaaaaagaagaaaatacgaattaataatgacatatatttaaag
aatcttccaacaaataaaaattatcaagttagttatatgcatacagatatagttactcat
gttgtggttagtaataaaaagaaatatataattacggctagtttaaatggtattataaaa
ttttggtataaaaatattggttgtattgaatttgtaaagcattttaaaattcattcagat
gaaattattaatatatttatatcagaagatgaagaacatttaggaagtttatcaaaagat
aaaacatataaacaatttgatattactagttttgatatgaatattgttataaaattaagt
tttattccaagaacaggagaatttatttactcctctatattttcaacagaggttaaagtt
gctatatcgtctagtgaaaaagcatgtatatatatttataaaccgttagaaagtgatatt
tgtatacaaaccattgatttcggttgttgtaatattatagaaattataaaatataataaa
ttttatgatttatgtgtattcagtgataatgaaggtcttcttgatattgtagatgtaacg
aattttaaatttccaacatcgaaagaggaaaagaaatcaaaaacaaataataatatggat
cataaattaattgattttatgaataaaagatatccaattaaaaaaattaatttttcattt
aaaagcgaaacagatctatatgaattatgcaaatataaaacttatgctttatgtataagt
ttaagtttagatggagaatatatggctatattatctgaaaattattttttgagaatttac
aaatttgaatccatgaaattatatagagtatatgatgaaagtacagaaatgtatttaact
gctcaaaatgatcctttaaaaaaagaattacatatagatagttttgattttggtaaaaga
ctttttattgaaaaagaaataaaaaaatatatgaaaaatcaaaatattaattttaatatg
atctcttttgatgaatcaaatcaatatattatttattcaacttttattggtataaaagtt
gttaattttataaccaatcaattgtgttatattattgggaaaaatgaagccaatttaaga
tacttatcaatttctatatatcaaaatatcatacccataaataaagttagaacaaatata
catgaatctttatatataaatgaaaaaaatatatccgattgtgctctgttttgtactgta
tacaaaaaagctagattttatgttttctcaaaaaaaaaattaaatgaacacgaattagat
gacagagatatatacaacgaacaaccaacaaaaaatgatgtaaattctcttatttcaaac
cctttaaaaaatatagaaaccattcataaaaatactcctaaaagtgctattatttacaca
accatgggagatatacatatttcacttttttataaagaatgcaaaaaaacagtacaaaat
ttctctgttcattctataaacggatattataataattgcattttccatcgagttatcaaa
cattttatggtccaaacgggagatccttcaggtgatggcacaggtggtgaaagtatttgg
ggaaatgaatttgaagatgaattctttgaccatcttaatcattccaaaccttttatggta
tctatggcaaactgtggtccaaatactaatggatcccagttttttataaccactgtccca
tgtccttggctcgattttaaacacacagtttttggtaaagtaacccaaggaagtaaaatt
gttttggatatagaaaaggttcgtacggataaaagggataagcctttagaggatatcaaa
atattaaatataaaaattaataattag

DBGET integrated database retrieval system