KEGG   Pyrococcus furiosus COM1: PFC_02125Help
Entry
PFC_02125         CDS       T02183                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00240  Pyrimidine metabolism
pfi00250  Alanine, aspartate and glutamate metabolism
pfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PFC_02125 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PFC_02125 (pyrB)
Enzymes [BR:pfi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PFC_02125 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2CSK_N Porin_1
Motif
Other DBs
NCBI-ProteinID: AFN03392
UniProt: I6U662
Position
complement(422570..423496)
Genome map
AA seq 308 aa AA seqDB search
MDWKGRDVISIRDFSKEDIEIVLSTAERLEKELKEKGQLEYARGKILATLFFEPSTRTRL
SFESAMHRLGGAVIGFAEASTSSVKKGESLADTIKTVEQYSDVIVIRHPKEGAARLAAEV
AEIPVINAGDGSNQHPTQTLLDLYTIRKEFGKIDGLKIGLLGDLKYGRTVHSLAEALAYY
DVELYLISPELLRMPRHIVEELREKGVTVYETSDLMSVIGELDVLYVTRIQKERFPDEQE
YLKVRGSYQVNLQVLSKAKETLKVMHPLPRVDEIHPEVDKTKHAIYFKQVFNGIPVRMAL
LGLVLGVI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggattggaaaggtagagatgttatcagcattagagacttttctaaagaagacatagaa
atcgtcctttctacagcggaacgccttgaaaaagagttaaaggagaagggacagctggag
tatgcaagaggaaagatacttgcaactctcttcttcgagccttcgacaagaacaaggttg
agctttgagagtgcaatgcacagactgggaggagcggtgattgggtttgctgaagcctcc
actagtagcgtgaagaagggcgaaagcttggcagatacaataaaaactgttgagcagtac
agtgatgtcatagtgattagacatccaaaagaaggagcggcaaggttagctgctgaggtt
gccgagataccggtgattaatgcgggtgacgggagtaatcaacacccaactcaaacactg
ctggatctctacactataaggaaggagtttggaaagatcgatgggttaaagatcggcctt
ttgggagatttaaagtatggaagaactgtgcacagccttgcagaggcattggcatattac
gatgtagagctgtacctaatctcacctgaactcctaaggatgcctcgacacatagtcgag
gagctcagggaaaagggagtaacggtctacgagacctctgatttgatgagcgtcattgga
gagttagatgtgctctacgtgactagaattcagaaagagaggttcccagacgagcaagaa
tacctcaaagtcaggggaagttatcaggtaaacctccaagtgctttcaaaggccaaggaa
acgctaaaggttatgcatccacttccaagggttgacgaaattcatccagaagttgataaa
accaagcacgcgatctactttaagcaagtgtttaacggaattcccgtaagaatggccctc
ttgggcctagtcttgggggtgatttga

DBGET integrated database retrieval system