KEGG   Pyrococcus furiosus COM1: PFC_05005Help
Entry
PFC_05005         CDS       T02183                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00630  Glyoxylate and dicarboxylate metabolism
pfi01100  Metabolic pathways
pfi01110  Biosynthesis of secondary metabolites
pfi01120  Microbial metabolism in diverse environments
pfi01130  Biosynthesis of antibiotics
pfi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PFC_05005 (rbcL)
Enzymes [BR:pfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PFC_05005 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFN03948
UniProt: I6V1K5
Position
complement(907099..908361)
Genome map
AA seq 420 aa AA seqDB search
MKVEWYLDFVDLDYTPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWKMPEMA
KRSMAKVFYLEKSGEGYIAKIAYPLTLFEEGSIVQLLSAIAGNIFGMKALKNLRLLDFHP
PYEYLRHFKGPQYGVKGIREFMGVKERPLTATVPKPKMGWSVDEYAEIAYELWSGGIDLL
KDDENFTSFPFNRFEERVKKLYRIRDIVEAETEERKEYLINITGSVDVMEKRAELVANEG
GQYVMIDIIVTGWSALQYMREVTEDLGLAIHAHRAMHAAFTRNPKHGITMYAIAKLARMI
GVDQIHTGTAVGKMAGDYEEVKRINDFLLSKWEHIREVFPVASGGLHPGLMPELIRLFGK
DLVIQAGGGVMGHPDGPRAGAKALRDAIDAALEGVDLEEKAKSSPELKKALDKWGYLKPK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgagtggtatttagacttcgttgacttggactacactccaggtagagatgag
ttaattgtggagtattactttgaaccaaacggggtttctccagaagaagcagccggaagg
atagctagtgaaagctctataggaacgtggacaactctctggaaaatgcccgaaatggct
aagaggagtatggctaaggtattttatctagaaaaaagtggggagggatatattgctaag
attgcatacccattaacgcttttcgaagaaggaagcatagttcaacttttgagtgcgata
gctgggaacatcttcggaatgaaagcgttaaagaatttgaggcttctggacttccatccc
ccttatgagtatctgagacatttcaaagggccacagtatggtgtaaagggaattagagaa
ttcatgggggttaaagagagacctttgactgctaccgttccgaagcctaagatgggatgg
agtgttgatgaatacgcggagatagcatatgaactctggagtggagggatcgatctgtta
aaagacgatgaaaacttcactagctttccattcaacagatttgaagagagagtgaaaaaa
ttatataggattagggatatcgtggaggctgaaactgaggaaagaaaagagtacctaatc
aacattactggatccgttgatgttatggagaaaagagccgaactagtggcgaatgaggga
gggcagtacgttatgatagacataatagtcactggatggagcgcactccagtacatgaga
gaggtaactgaggatcttggattggctatacatgcccacagagccatgcatgccgcgttc
actagaaatcccaagcacgggataacgatgtatgcaatagccaagcttgccagaatgatt
ggcgttgatcaaattcacacggggactgcagttggaaagatggcaggtgattatgaggag
gttaaaaggataaacgacttcctacttagtaaatgggagcacataagagaagttttccca
gtagcaagtgggggacttcaccctggattgatgccagagcttatacgtctcttcgggaaa
gatctcgttattcaagcgggtggaggagttatggggcacccagatgggcccagggctgga
gctaaagccttgagagatgcaatagatgcggctttagaaggggttgatttagaggagaag
gcaaagtcgagtccagagctgaaaaaggcattagacaagtggggctacctaaagcctaaa
tga

DBGET integrated database retrieval system