KEGG   Pyrococcus furiosus COM1: PFC_07720Help
Entry
PFC_07720         CDS       T02183                                 

Definition
(GenBank) 43 kDa subunit bacteriochlorophyll synthase-like protein
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pfi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PFC_07720
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     PFC_07720
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     PFC_07720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Lycopene_cycl FAD_binding_2 FAD_oxidored DAO Trp_halogenase Pyr_redox_2 HI0933_like NAD_binding_8 GIDA 3HCDH_N Thi4 DUF596 SE BCAS2
Motif
Other DBs
NCBI-ProteinID: AFN04478
UniProt: I6V2W3
Position
complement(1390776..1391957)
Genome map
AA seq 393 aa AA seqDB search
MKYDVVVVGSGVAGPIVARDVAKAGFSVLLVDKKPAIGTPKQCAEGINVNVFKEFDIPYD
KRFINREIYGARIYSPSGYTAELRYDKVSGVILERKVFDKMLAYYAAKAGADVWARTEVI
DLLRKEGKIMGVKAKHEGELVEIEAKIIVAADGVESTVARLAGINTYAPPHEFDSAYEYE
MIIEGYDPDLIHLWFGNEIAPRGYVWVFPKDEDRANVGIGINSDNEKTAKYYLDKWLKEN
NIPTKKILEINVGLVPVGGFVRELVKENVAVVGDAARQVNPVHGGGMYEAMKAANILAKW
IVKALEEENLELLKNYTKEWWEVEGPKMERLLKLRRAMEKLTDEDIDVFVQLLGGTDLEK
LAGGNYFEVVKALMKHPKVLMSKRRLEILKALL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgatgtagtggttgttggctcaggagttgccggtcccattgtggcaagagac
gttgcaaaagctggtttttcagttcttcttgtggataaaaaacctgcaattggaactcca
aaacagtgtgcagagggaataaatgttaacgttttcaaggaatttgacattccatatgat
aaaaggttcataaacagagagatttatggggcgaggatttactctcctagtggatatacg
gccgagcttaggtatgacaaggtaagtggagttatacttgagagaaaagtctttgataaa
atgctcgcctattatgctgcaaaggctggagctgatgtttgggcaaggaccgaagttatc
gatctcctaagaaaggaaggtaagattatgggggttaaggcaaaacatgaaggcgagtta
gtcgaaattgaggctaagataatagtagcggctgatggagttgaaagcacagttgcaagg
cttgcggggataaatacctatgctcctccccatgaatttgattcagcgtatgaatacgaa
atgataatcgaaggatacgacccagacttaattcatttgtggtttggaaatgaaattgct
cctagaggatatgtttgggtatttccaaaagatgaagatagggcaaacgtcggaattgga
ataaactccgacaatgagaaaactgccaagtactatctggacaagtggcttaaagaaaac
aacattcccacgaagaaaatattggagataaacgttggccttgttccagtgggtggcttt
gtaagagagttagttaaagaaaacgtggctgtagttggagatgccgccaggcaagtaaat
ccagtccatggaggaggaatgtatgaagcaatgaaagctgctaacattttggcaaagtgg
atagttaaggcactggaggaggagaatctagaactactgaagaactataccaaagagtgg
tgggaagttgaagggcccaagatggagagactactgaagcttagaagggcaatggaaaaa
ctaacagatgaggacatagatgttttcgttcaattacttggagggactgacttagaaaaa
ctagctggtggaaattatttcgaggtagtaaaagctctcatgaagcatccaaaagtgtta
atgagcaaaagaaggttagaaatactcaaggctctattatga

DBGET integrated database retrieval system