KEGG   Pyrococcus furiosus COM1: PFC_08320Help
Entry
PFC_08320         CDS       T02183                                 

Definition
(GenBank) peptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00300  Lysine biosynthesis
pfi01100  Metabolic pathways
pfi01120  Microbial metabolism in diverse environments
pfi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PFC_08320
Enzymes [BR:pfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PFC_08320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AFN04594
UniProt: I6TYP5
Position
complement(1513296..1514606)
Genome map
AA seq 436 aa AA seqDB search
MDVLELLSQLVEFETVNDPAKGIKPTKECPKFIKDTLEEWEVEADVFEENGYYGVLGEIG
KGYPKLLFMAHFDVVPVNPEEWNTDPFKLTIIGNKAYGRGSVDDKGNVAAVMVALKELAK
EDIKGKIIFAFTGDEEIGGFLASKIAERLKEENKLPKYMINADGIGMKPIIRRRKGFGAV
IRVPIKKIKVKGKIKSKTFKVNTPILETRHAAYFLPGVDTHPLIAASHFVRTKEVPVVSL
EGKFLKGNVVPSEVTLTYLERGDGEEVEVDLGLTELMRSIVPVVRAPIKAEKYSDYGVSI
TPNMYSIENEKHVLRLDIRAMSNSKEDIEKTLKEVISFTLPEGELEVKTNEKAGYLFTSP
EEKIVKVALEVLRELGEDVKPVEGPGASDSRYFTPYGVKAIDIGPKGGNIHGPNEFVEID
SLKKMPKVYKEIALRL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgcttgaacttctttctcaattggttgagttcgaaaccgttaatgatccagca
aagggaataaaacccaccaaagaatgtcccaagttcatcaaagatacgctggaagagtgg
gaagttgaagctgacgtttttgaagagaacggctattatggagtattaggggaaattgga
aaaggttatccaaagctcctcttcatggctcacttcgacgtagtcccagtaaatccagaa
gagtggaacacagatccattcaaattaaccataataggaaacaaagcgtatggaagggga
agcgttgatgataaagggaatgttgctgcggtgatggtagcactaaaagagcttgcaaaa
gaagatatcaaaggaaaaataatctttgcctttactggagatgaagaaattggaggattc
ctcgctagcaagattgctgagagattaaaagaagagaacaagctaccaaagtacatgatc
aatgcagacggaataggaatgaaaccaataattaggagaagaaaggggtttggagcggtt
attagagttccgattaagaagatcaaggttaaagggaaaataaaatccaaaacattcaag
gtaaacaccccaattttagaaacaagacatgctgcatattttctcccaggagtagacact
catccactaatagcagcttcacacttcgtaagaacaaaagaagtccctgtagtttccctt
gaggggaaattcttgaaaggtaacgttgttcccagtgaagttactttaacttaccttgaa
agaggagatggagaagaagttgaagtggaccttggattgacagagctgatgaggtcaata
gttccagttgtgagggctccaataaaggcggaaaaatacagcgactatggagtgtcaata
acgccaaacatgtattccatcgaaaacgaaaaacacgttttaaggctcgatataagggcg
atgagtaattcaaaagaagatatcgaaaagacattaaaagaagttatctcgttcactttg
ccagagggagaactcgaagtcaaaactaacgaaaaagcaggttatctcttcacaagtcct
gaagaaaagatcgtgaaagttgcattggaagttctcagagagcttggcgaagatgttaaa
ccagttgagggtcctggagcctcagattcaaggtacttcaccccatatggcgtaaaggca
atagatatcgggcctaaaggaggaaatatccacggacctaatgaattcgttgaaatagac
tccctaaaaaagatgccaaaagtgtataaggaaattgcactaaggctttga

DBGET integrated database retrieval system