KEGG   Pyrococcus furiosus COM1: PFC_08975Help
Entry
PFC_08975         CDS       T02183                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pfi  Pyrococcus furiosus COM1
Brite
Enzymes [BR:pfi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PFC_08975 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 RrnaAD Methyltransf_11 Fibrillarin PrmA Ubie_methyltran CMAS Methyltransf_18 Methyltransf_3 GCD14 MetW Methyltransf_4 tRNA_U5-meth_tr Methyltransf_2 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AFN04718
UniProt: I6V3I3
Structure
PDB: 

Position
1630872..1631636
Genome map
AA seq 254 aa AA seqDB search
MAPVRIVPFLLEFIKIILEQTKNIVMHLYSSDFPLMMDEKELYEKWMRTVEMLKAEGIIR
SKEVERAFLKYPRYLFVEDKYKKYAHIDEPLPIPAGQTVSAPHMVAIMLEIANLKPGMNI
LEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPP
KAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGG
VAFVPLIGEYGWKE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcacctgtcagaattgtaccttttctgctggaatttataaagattattttggaacaa
acaaagaatatagtaatgcatttatactcttcagattttcctctaatgatggatgagaaa
gaactttacgaaaagtggatgcgaacagtggaaatgttgaaggctgagggaataattaga
agtaaggaagtggagcgagcatttctaaaataccctcgatacttgtttgtggaagataag
tacaaaaaatacgctcacattgatgagcctcttccaattccagcaggccagacagtctcg
gctcctcatatggtggcaataatgcttgagatcgctaatctaaaacctggaatgaatatt
cttgaagtgggaactggaagtgggtggaatgctgccttgatttctgaaatagtcaaaacg
gatgtatacacaatagaaaggatccctgaacttgtggaatttgcaaaaagaaacttggag
agagcaggcgtaaagaatgttcatgtaattttgggagatgggagtaaaggatttcctccc
aaggctccctatgatgttattatcgtcacagctggtgctccaaagattcccgaaccactt
attgaacagttaaaaattggtggaaagttgataattcctgtaggtagctatcacctctgg
caagagcttttagaagttaggaaaactaaagatggcattaagatcaaaaaccatggtggg
gtagccttcgttcctttaataggggaatacgggtggaaagaatga

DBGET integrated database retrieval system