KEGG   Pandoraea fibrosis: PI93_011790
Entry
PI93_011790       CDS       T06385                                 

Definition
(GenBank) protocatechuate 3,4-dioxygenase
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
pfib  Pandoraea fibrosis
Pathway
pfib00621  Dioxin degradation
pfib01100  Metabolic pathways
pfib01120  Microbial metabolism in diverse environments
pfib01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pfib00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PI93_011790
Enzymes [BR:pfib01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     PI93_011790
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: QHF13242
Position
2641018..2641836
AA seq 272 aa
MGKIVSAAATSHTFGVADGVEAQAQRIFDGIDRIGHAIRASRPDVILMATSDHLVNFSLD
FQIPLAVGISDAWCPYGDLGVPREPFPGHREFATELVAFAATKDFDLVAVENVKPDHGLA
MPNAIINRGMHIPVVPIYINTVMAPSPTCARSYALGKAVREFVETARPEQERVAIVATGG
LSHWICLPDSGRVNAKWDLALIQQIVTGRGAELAGLSFDAIMKDGGNGGLEMATWAFMAG
TTGESVGELVYYEEMTAWWTGMGGVLMHLDDA
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggaaagattgttagcgcggcggcaacctctcatacatttggtgtggcagatggggta
gaggctcaggcgcagcgcatattcgacggcattgaccgaatcggtcatgccattcgggcg
tcaaggccggatgtgattttgatggcgaccagcgaccatctcgtcaatttctctctggat
tttcagattccgctggccgtggggatctcggatgcgtggtgcccttatggcgatcttggt
gtgccccgggagccgttccccggacaccgcgagttcgccaccgagcttgtcgcgtttgcg
gcaacaaaggacttcgaccttgttgccgtggagaacgtcaagccggatcacgggctcgcc
atgccgaacgcgatcatcaatcgcgggatgcatatccctgtggtgcccatctacatcaat
acggtgatggccccgtctccgacctgtgcgcgcagttacgcgttgggaaaggcggtgcgc
gaatttgtggagaccgctcggccggagcaggagcgcgttgcgattgtcgcgacgggaggg
ctgtcccactggatttgtttgcccgattcgggacgcgtgaatgcgaagtgggacctggcg
ttgattcagcagatcgttaccggtcgtggcgccgagctagcggggttgtccttcgacgcg
atcatgaaggacggagggaacggggggctcgagatggccacgtgggccttcatggccggt
accacgggagagagcgtgggtgaactggtctattacgaggaaatgactgcctggtggacc
ggaatggggggcgtactcatgcatctggatgatgcttga

DBGET integrated database retrieval system