KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_128096Help
Entry
MYCFIDRAFT_128096 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K20003  palmitoyltransferase ZDHHC4 [EC:2.3.1.225]
Organism
pfj  Pseudocercospora fijiensis
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pfj04131]
    MYCFIDRAFT_128096
Enzymes [BR:pfj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     MYCFIDRAFT_128096
Membrane trafficking [BR:pfj04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    MYCFIDRAFT_128096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 19330670
NCBI-ProteinID: XP_007921276
JGI: 128096
UniProt: N1QAT1
Position
Unknown
AA seq 387 aa AA seqDB search
MSALRKLVLAILILSLITFIALFGRLPAFRRTPMGWLNRLLCLHIPNGFRKVDRTLTGGQ
ITRRSQRVGQYLFYEKNPIVLIIFLVLLTGSAGLFLHNTLHLLPPHLLAPIPPFLIAPYI
FTYLTVSYKAHYITASNHKARSVDYPYDHILFRPGNVCSTCNLDKPARSKHCSFCGHCVA
KCDHHCPWVNNCLGRGNYRWFLALLFSLGAVEIYGAYLSWHILGPSMRMDRTTPLVSWAR
LEQIGNAVVVAVNKGGLSIAGVGLLAASTAGLPLGLLAYHLYLIWAGMTTNESQKWSDWQ
EDMADGFVFMAKIEDLRTHHPLFAFDDADEVVVPWPVNTEQVLVMTKDGKPPRGQDGLWN
RVWSLDDVDNIYDLGGLQNFLQVINGK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcttcgaaagcttgtccttgcgatcctgatcttatcgctaatcaccttcatc
gcgctgtttggtcgactgccggctttcaggagaacacccatgggctggctgaatcgactg
ctttgtcttcacataccgaatggctttcgcaaagtggatcgaactctcaccggtggccag
atcacgcgcaggagccagcgggtcggacagtacctgttttatgagaagaatcccatcgtt
ctgataatctttttggttctgcttacaggaagtgctgggctgttcctacacaacacactg
cacttgcttccgcctcatctcctggcgcctattccaccatttctgatagccccatacatc
ttcacatacctcacagtctcatacaaagcacactacatcacagcttcgaaccacaaggcg
agaagcgtggactacccttacgaccacatcctgttccggcccgggaacgtgtgcagcact
tgcaatttggacaagccagcacgatcaaagcactgcagcttttgcggacattgcgtggcc
aaatgtgaccatcactgtccatgggtgaacaactgtcttggacgaggcaattaccgctgg
ttcttggccttgctgttctctctcggcgcagttgagatatatggtgcgtacctgagctgg
cacatacttggaccttctatgcgcatggacaggactactcctttggtcagctgggcacgc
ttggagcagataggcaacgcagtagtggtcgcggttaataagggtggcctttccattgcc
ggtgtcggtctccttgccgcgagcacggcgggccttccccttggattgttggcgtatcat
ttatacctgatctgggctggcatgactacaaacgagtcacagaaatggtcggattggcag
gaagacatggcggacgggttcgtattcatggccaaaatcgaagatttaaggacgcatcac
ccgttattcgctttcgacgatgctgacgaagtggttgtaccgtggccggtcaatactgag
caagttctggtaatgacgaaggacggcaagccaccgcgaggacaagacgggctgtggaat
cgtgtctggagcttggacgacgtcgacaatatttatgaccttggtggcctgcagaacttt
ttgcaggtgataaacggcaaatga

DBGET integrated database retrieval system